KEGG   Bacillus lehensis: BleG1_1521Help
Entry
BleG1_1521        CDS       T03204                                 

Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ble  Bacillus lehensis
Brite
Enzymes [BR:ble01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BleG1_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIC94099
UniProt: A0A060M215
LinkDB All DBs
Position
1473672..1474280
Genome map
AA seq 202 aa AA seqDB search
MAYKLPELPYAANALEPHIDEQTMTIHHGKHHNTYVTNLNAALEGHEDLASKDIEDLVAN
LDSVPENIRTAVRNNGGGHANHALFWQLLSPNGGGAPTGALANDIDSTFGSLDEFKTKFA
DAAKGRFGSGWAWLVVNNGNLEITSTPNQDSPLTEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVAKRYEAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaattaccagaattaccttatgcagcaaatgcgctagaaccacacattgat
gaacagacgatgacgattcatcacggtaaacaccacaacacctatgttacaaacttaaac
gctgctctagaaggtcacgaagatcttgcaagcaaagacatcgaggatcttgttgcaaac
ttagattctgtaccagaaaacatccgtacagcagtacgcaacaacggcggtggacatgct
aaccatgcattattctggcagttattaagcccaaatggtggcggtgctccaacaggtgcg
ttagcaaatgatatcgattctacatttggtagccttgacgaattcaaaacaaaatttgct
gatgcagcaaaaggtcgttttggttctggttgggcatggcttgttgtaaacaatggcaac
ttagaaatcacaagcacaccaaaccaagattctcctcttactgaagggaaaacacctatt
ttaggattagatgtatgggagcatgcatactacttaaattaccaaaatcgccgtcctgat
tacatttcagcattctggaatgttgtaaactgggatgaagtggctaagcgctacgaagca
gcaaaataa

DBGET integrated database retrieval system