KEGG   Bacillus lehensis: BleG1_2302Help
Entry
BleG1_2302        CDS       T03204                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ble  Bacillus lehensis
Brite
KEGG Orthology (KO) [BR:ble00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ble01001]
    BleG1_2302
Enzymes [BR:ble01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BleG1_2302
Protein kinases [BR:ble01001]
 Serine/threonine kinases: Other
  Bacterial family
   BleG1_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Haspin_kinase RIO1 Kdo UL45 DUF4287 Pkinase_fungal Pinin_SDK_N
Motif
Other DBs
NCBI-ProteinID: AIC94880
UniProt: A0A060LYM8
LinkDB All DBs
Position
complement(2246955..2249048)
Genome map
AA seq 697 aa AA seqDB search
MIGERIGDRYVVLDSIGGGGMANVYLALDVILDRHVAVKVLQPQFSKDEQFIKRFRREAQ
AATSLNNPHIVNIFDVGEEEDLYYIVMEYVKGRTLKEVIQEDGPLDIATALDYFKQILHG
VGHAHAMQIVHRDMKPQNILISEDGEAKVTDFGIARAMTSTTITHTNSVMGSVHYLSPEQ
ARGGHVTYRSDLYSLGIVLFEMVTGRIPFSGDTAVSIAIKHLQNDIPSAKELVSSIPQSV
EDIIKKATMKDPSQRFNSAEDVIWACDMALDPNQSLQLHTQSEEADEEKTKELPIVAGFS
NNEDQDKTIEIPVQKQESVPIEAVNQEDPKKEAEQTKKPAKKKKKWLWISIIGIGVLIGA
FILALTLWSEVFFVEETTIPDVEGMEENEAIDEIENQRLIANVEPISTDEYEPGQVANQS
PRAGRTVKEGSEVTLYVVASREEVTLDDYSGYTFTQAERLLEQLGFEVEEQSREDNSAQE
GTVISQSPSNGSSVVPADTTVVLTVAVPETIQLDDLVNQTEEDVRAYFNAEGLRGTFERE
HDEDIPAGRVIRQSPEPLTTMEQGDRVEIVLSRGPEPNQPDETPEVPQQPEGEVEDPVAA
DPVEDPTEEEEPSSVYRVTQTVVVSEEHQSEERSFAVRIVATDANSQGDERVVIEETITT
TTDFTIDLRVSPSYPGSYEVFIDDEFNRESDVYEYEE
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgattggagaacgaattggcgaccgctacgtcgttttggacagcatcggcggaggtggg
atggcgaatgtctatttagcacttgatgttattttagatcgtcatgtcgcagtaaaagta
cttcagcctcaattctcaaaagacgaacagttcattaagcgctttagaagagaagcgcaa
gcagcaacaagtttgaataatcctcatatcgtcaatattttcgacgttggagaagaagaa
gatctttattatattgtcatggagtatgtaaagggccgtacgctaaaagaagtcattcaa
gaagatggtcctttagatattgccactgcccttgactatttcaaacaaattttgcatggc
gtaggacatgcccacgctatgcaaattgtccatcgtgatatgaaaccgcaaaatattctt
attagcgaagatggggaagcaaaagtaactgactttgggattgctcgtgcaatgacatcc
acgacaattactcatacaaattcagtcatgggatccgttcactatctatctcccgaacaa
gctcgtggcggtcatgtgacgtaccgttctgacttatactcgttagggattgttctattt
gaaatggtaacaggaagaattccgttttctggagatactgctgtatctattgcaattaag
catttgcaaaacgatattccatcggctaaggaactagtatcgagtattccgcaaagtgtg
gaagacattataaaaaaagcaacgatgaaagacccgtcacaacggtttaattctgcggaa
gacgtcatctgggcttgtgatatggcgttagatccaaatcaatccttgcagttgcatact
caatcagaagaagctgatgaagaaaagacgaaagaactaccgattgtagctggcttttcg
aataatgaagatcaagataaaacgattgaaattccagtacaaaaacaagagagtgtccca
atagaggcagtcaaccaagaagatccaaaaaaggaagcagaacaaacaaaaaagccagcg
aaaaagaaaaagaaatggctgtggatcagtattattggcattggtgtattaataggggcg
tttatcctagcgctaacgttgtggagtgaagtgttttttgtagaagaaacaaccatacct
gatgtggaaggaatggaagagaacgaagcaattgatgaaatcgaaaaccaacggttgata
gcaaacgttgagccgatctcaacagatgaatatgaacccggacaagtagcaaatcaatct
ccacgagctggtcgtacggtgaaagaaggatcggaagttactctatatgtcgtagcatcc
agagaagaagtaacgttagatgactactctggttatacgtttacacaagcggagcgtttg
cttgagcagcttggttttgaagtggaagagcagtctagagaagataatagtgcccaagaa
ggaaccgtcatttcacaaagcccatcaaatggttcaagcgttgttccagccgatacgacg
gtggtactcactgttgctgttccagaaaccattcagctagatgacctcgtcaatcaaacc
gaagaagatgttcgggcgtattttaatgcagagggcttaagaggtacgttcgaacgcgag
catgatgaggatataccggcaggacgcgttattcgacaatcacctgaacctttaacaaca
atggaacaaggtgatcgtgttgagatagtgttatcccgaggacctgaaccaaatcaacca
gatgaaacccctgaagttccacaacaacctgaaggagaagtcgaggacccggtagccgct
gatcctgtagaagatcctacagaagaagaggagccaagctcggtctatcgagttacacaa
acagttgttgtttcagaagaacatcaatcagaggaacgtagctttgctgtgcgaatcgtc
gcaacagatgctaattcccaaggtgatgagcgggttgttattgaagaaaccattacgacg
acaacagattttacgattgatttacgggtcagcccaagctacccaggttcgtatgaagtc
tttatcgatgatgagtttaatcgagaatcggatgtgtatgaatatgaagaataa

DBGET integrated database retrieval system