KEGG   Bacillus lehensis: BleG1_2712Help
Entry
BleG1_2712        CDS       T03204                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ble  Bacillus lehensis
Pathway
ble00010  Glycolysis / Gluconeogenesis
ble00030  Pentose phosphate pathway
ble00051  Fructose and mannose metabolism
ble00052  Galactose metabolism
ble00680  Methane metabolism
ble01100  Metabolic pathways
ble01110  Biosynthesis of secondary metabolites
ble01120  Microbial metabolism in diverse environments
ble01130  Biosynthesis of antibiotics
ble01200  Carbon metabolism
ble01230  Biosynthesis of amino acids
ble03018  RNA degradation
Module
ble_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ble00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BleG1_2712
   00030 Pentose phosphate pathway
    BleG1_2712
   00051 Fructose and mannose metabolism
    BleG1_2712
   00052 Galactose metabolism
    BleG1_2712
  09102 Energy metabolism
   00680 Methane metabolism
    BleG1_2712
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BleG1_2712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ble01009]
    BleG1_2712
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ble03019]
    BleG1_2712
Enzymes [BR:ble01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BleG1_2712
Protein phosphatases and associated proteins [BR:ble01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BleG1_2712
Messenger RNA biogenesis [BR:ble03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BleG1_2712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 GATase
Motif
Other DBs
NCBI-ProteinID: AIC95277
UniProt: A0A060LYL6
LinkDB All DBs
Position
complement(2632269..2633228)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGIEVYGISYGYQGLIEGDIKKMELGSVGDI
IHRGGTMLYTARCEEFKTLEGQKKGIEQLKKHGIEGLVVIGGDGSYRGAQKLSEHGFPTV
GVPGTIDNDIPGTDFTIGFDTALNTIIDAIDKIRDTATSHERTYVIEVMGRHAGDLALWA
GLADGAETIVIPEEEHDMNLILANIKRGVERGKKHSIIIVAEGVGSGFDFGEKISAEMNV
ETRVTVLGHIQRGGSPTGADRVLASRLAAKAVDLLLEGKAGMTVGIQRNEIVYHSINDIL
DQPHKIDTDMYKLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtattggtgtattaacaagtggtggcgattcacctggtatgaatgcagcgatt
cgcgcagttgttcgaaaagcaatttatcatggaattgaagtgtatggaatttcttatggc
tatcaaggcttaattgaaggcgatattaagaaaatggagctcggctcagttggagacatt
atccaccgtggtggcacaatgttatatacagcacgatgtgaagaattcaaaaccctggaa
ggacaaaaaaaggggattgaacaacttaaaaaacacgggattgaaggacttgtcgtcatt
ggtggagatgggtcttatcgtggcgcgcaaaaattaagcgagcatggattcccaacagtc
ggtgtcccaggaacgattgacaacgatataccaggaacagactttacaattgggttcgat
acagcgttaaacactattattgatgccattgataaaattcgtgacactgctacatctcat
gagcgtacgtacgttattgaagtaatgggtcgacacgcaggagatcttgcgctttgggca
gggcttgcagatggtgctgagacaatcgtcattcccgaggaagaacatgacatgaatctg
attcttgctaacattaaacggggtgttgagcgaggcaaaaagcatagtattattattgtt
gctgaaggtgttgggtcaggctttgactttggtgaaaaaatcagtgctgaaatgaatgtg
gaaacacgtgtaacggtactaggacatattcagcgcggtggttcaccaactggagcagac
cgagtgcttgctagccgtttagctgcaaaagctgttgacttattattagaaggaaaagcg
ggcatgactgtaggcatacaacgtaatgaaattgtttatcattccattaatgatatttta
gatcaaccacataaaattgacacagatatgtacaagctttcgcaagaactgtcgatttaa

DBGET integrated database retrieval system