KEGG   Beggiatoa leptomitiformis: AL038_00520Help
Entry
AL038_00520       CDS       T04090                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep00630  Glyoxylate and dicarboxylate metabolism
blep01100  Metabolic pathways
blep01120  Microbial metabolism in diverse environments
blep01200  Carbon metabolism
Module
blep_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:blep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AL038_00520
Enzymes [BR:blep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AL038_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ALG66495
UniProt: A0A2N9YCM5
LinkDB All DBs
Position
106117..106536
Genome map
AA seq 139 aa AA seqDB search
MRVTQGTFSFLPDLTDEQIRAQVEYCLQNNWAIGVEFTDDPHPRNSYWDMWQMPMFDLKD
AAAILYEINACRKAYPNHYIKVNAFDSSRWRESLAMSFIVNRPAEEPGFGLVRQECEGRT
IRYTIHSYATDKPEGSRYK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcacccaaggtactttttcttttttacctgatttaaccgatgagcaaattcgc
gcccaagtcgaatattgtttgcaaaacaactgggcaattggggtcgagtttacggatgac
ccacacccacgcaatagttactgggatatgtggcaaatgcccatgtttgatttaaaagat
gctgctgcaattctgtatgaaatcaatgcgtgtcgtaaagcctacccgaatcattatatt
aaagtgaatgcctttgattctagccgttggcgggaatcgttagcgatgtcttttattgtc
aaccgccccgcagaagaaccggggtttggtttggtacgtcaagaatgtgaggggcggaca
attcgttacacaatccacagttacgcaactgacaaacctgaaggcagccgctacaaataa

DBGET integrated database retrieval system