KEGG   Beggiatoa leptomitiformis: AL038_09530Help
Entry
AL038_09530       CDS       T04090                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
blep  Beggiatoa leptomitiformis
Pathway
blep00061  Fatty acid biosynthesis
blep00780  Biotin metabolism
blep01100  Metabolic pathways
blep01130  Biosynthesis of antibiotics
blep01212  Fatty acid metabolism
Module
blep_M00083  Fatty acid biosynthesis, elongation
blep_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:blep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AL038_09530
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AL038_09530
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AL038_09530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:blep01004]
    AL038_09530
Enzymes [BR:blep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AL038_09530
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AL038_09530
Lipid biosynthesis proteins [BR:blep01004]
 Fatty acid synthase
  Component type
   AL038_09530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ALG67907
UniProt: A0A2N9YHG6
LinkDB All DBs
Position
2278680..2279471
Genome map
AA seq 263 aa AA seqDB search
MGFLAGKRALIVGLASTRSIAWGVAQAMHREGAELAFAYQGEKLKERVEKMAGECGSSLI
FPCDVQSDEQIQSVFDNLAKTWDGLDIIIHSVAFAPAEELKGRYLDNASREGFRMAHDIS
SYSFSALAMAGRQMMQGRKAALLTLSYLGAERAMPNYNVMGLAKASLEANMRYLAYSLGE
EGIRVNAISAGPIRTLAAAGIADFRSMLDYVQENAPLRRNVTIEEVGNVAAFLCSDLASG
VTGEVTYVDCGFNTIGMGGYKKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttagcaggtaagcgtgcgttaattgtcggcttagccagtacccgttctatt
gcatggggcgttgcccaagccatgcaccgcgaaggcgcggaattggcttttgcttatcaa
ggggaaaaattgaaagaacgggtagaaaaaatggcgggagaatgtggttcttctcttatt
tttccttgcgatgtacaaagtgatgaacaaatccaaagtgtatttgataatctcgccaaa
acatgggatggcttagatattattattcattctgttgcgtttgcccctgcggaagaatta
aaaggtcgctatttagacaatgcttctcgtgaagggtttcgcatggcacatgatattagt
tcttatagcttttctgccttagcaatggcaggtcgacagatgatgcaaggacgcaaggcc
gccttattaaccttgagttatttaggggcagaacgtgcaatgcctaattacaatgtgatg
ggattagcaaaagccagtttagaagcaaacatgcgttatttagcgtacagtttgggagag
gaaggcatacgggtaaatgccatttccgcagggcctattcgtacattagccgcagcgggt
attgccgattttcgtagtatgttggattacgtgcaggaaaatgcaccgttacggcgtaac
gtaacgattgaggaagttggcaatgttgctgctttcctttgttccgatttagcgtcaggc
gttacaggtgaagttacctatgttgattgtggatttaacaccataggtatgggtggctat
aagaaggcttaa

DBGET integrated database retrieval system