KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1217Help
Entry
BLIF_1217         CDS       T01420                                 

Definition
(GenBank) putative serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
blf  Bifidobacterium longum subsp. infantis 157F
Brite
KEGG Orthology (KO) [BR:blf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:blf01001]
    BLIF_1217
Enzymes [BR:blf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BLIF_1217
Protein kinases [BR:blf01001]
 Serine/threonine kinases: Other
  Bacterial family
   BLIF_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like YflT Haspin_kinase RIO1 Kdo GCOM2
Motif
Other DBs
NCBI-ProteinID: BAJ71357
UniProt: E8MUB3
LinkDB All DBs
Position
1405307..1407607
Genome map
AA seq 766 aa AA seqDB search
MIKGTVRYNMSENEPAQMIEGRYRIVRNIAEGGMATVYEAIDERLGRTVAIKVMHTQLAK
GPHREQFVERFRREANSAASIANPHIVQVYDTGEFNGLDFLVMEYVHGVNLRHEMNAQGT
FSVRETLRVVAETLDGLASAHRAGVVHRDIKPENILINDRGHVQITDFGLAKAASQATLS
STGMLLGTAAYLAPEMIENNQATAQGDLYSVGIMAWEMLTGKVPFDSDNPVTLVFKHVHE
DVPSVATVCQGIDPSVAAFIAHLTARQVDARPTDGAAAAEELSQLAAKLPLEAWQYRLHA
EPIGGDHTDATAAALVGNIAEQAPLTGVPAGAATFKPSVPAFLADDVASNTVDTGGAADV
NPPAPPVAPTTALDSSTPADASAPHKTQIMAQSGSETQVLPQAGDAFTRALAFSDEPDVA
SNGTGPKKQRSKKPLIIVLVIVLVLAAIGGTAGWWWFAGPGSYWSVPKPDDVTCDANAST
ECSLAGADWATYESTLKALGIPYKTHKEYSDDVAEGKIISSSVNKTKAVVNSRISKRANQ
ELTVVVSKGVRMTTIPKDILDANSANGKDPLNALKKAGFDNVKHDESKDEYSMDTPQGVA
LTISPDPGTTAKHNDEVTVTLSKGPMPVTMPNIVGKTQDEMQAALGELKLTANVTEQYDD
KVEAGQVISASQEAGAQLKWGDSVDVVISKGPEMATIPSGLVGKQESAVTKTLEGLGFEV
KTDKVLGGLFGTVRTVKSGDTDLSNGGKIRLRDANGNPTVITLTIV
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaggaaccgtacgatacaacatgagtgagaacgagcccgcacagatgattgag
ggacgctaccgcatcgtgcgcaatatcgccgagggtggtatggccaccgtgtatgaggcc
atcgatgagcgtctggggcgcaccgtggcgattaaggtcatgcacacacaactcgccaaa
ggcccgcatcgggagcagttcgtcgaacggttccgccgcgaggccaattcggccgcgtcc
atcgccaacccgcacatcgttcaggtgtatgacaccggcgagttcaatggacttgatttt
ctggtcatggaatatgtgcatggcgtcaatctgcggcatgagatgaacgcccaaggcaca
ttctccgtacgtgagacgctgcgcgtggtcgcggagacgctggatggtctggcttccgca
catcgcgccggcgtggttcaccgtgacatcaagcccgagaacattttgatcaatgatcgc
ggccatgtgcagatcactgatttcggtctggccaaggccgccagccaggccacattgagc
tccaccggcatgctattgggcaccgccgcttatctggctcccgaaatgatcgagaacaat
caggccaccgcgcaaggcgacctgtattcggtgggcatcatggcatgggagatgctgacc
ggcaaggtgccgttcgattcggataatccggtgacgcttgttttcaagcatgttcatgag
gacgtgccgtccgtggccacggtctgtcagggcattgatccgtccgtggcggcgttcatc
gcccatctgaccgcgcgtcaggtggatgcccgccccaccgatggcgcggcagcagctgag
gaattgagccagttggccgccaaattgccgctggaggcgtggcaataccgtttgcatgcc
gaacccatcggaggtgatcataccgatgccaccgctgcagcgctggtaggcaatatcgcc
gagcaggccccgctgaccggcgtacctgccggtgcagcaacgttcaagccgtccgtacca
gcgtttttggccgatgatgtcgcaagcaataccgtcgataccggtggcgccgcagacgtc
aatcctccggctcctccggtcgcccccaccacggcacttgattcgtcgacgccagccgat
gcttcggctccccataagacgcaaatcatggcacagtccggcagcgagacacaagtgctg
cctcaggccggcgatgccttcacccgagcgcttgccttttccgatgagccggacgtcgct
tccaacggcaccgggccaaagaagcagcgcagcaaaaaaccgctcatcatcgtactggtg
atcgtgctggtactggctgcaatcggcggaaccgccggctggtggtggtttgccggaccg
ggcagctattggagtgtgcccaagccggatgacgtgacctgcgatgcgaatgcaagcacc
gaatgctcgttggccggcgcggattgggccacgtatgagagcacgttgaaggctctcggc
atcccctacaagacgcacaaggaatacagcgacgacgtggcggaaggcaagatcatctct
tcttccgtgaacaagaccaaggccgttgtgaacagccgcataagcaagcgagccaatcag
gagcttacggtggtggtgtccaagggcgtgcggatgaccaccatcccgaaggatattctc
gacgcgaattcggccaatggcaaggacccgttgaacgcgctcaagaaggccggcttcgat
aatgtcaagcatgacgagtcgaaggatgagtattcgatggacacgccgcagggtgtggca
ttgacgatctcccctgatcccggtaccacggccaagcacaacgatgaggtgacggttact
ttgagcaagggaccgatgccggtgaccatgcctaacatcgtcggtaagacccaggatgag
atgcaagccgcgctcggcgagttgaagctcacggccaatgtcaccgaacagtacgatgac
aaggtcgaggccggtcaagtcatttccgcgtctcaggaagccggagcccagctgaagtgg
ggcgatagcgtggacgtggtgatttccaagggtccggagatggcgacgataccgtccggc
cttgtcggcaaacaggaaagcgccgtaaccaagacacttgaaggtctcgggttcgaggtg
aaaaccgacaaggtgctcggtggcctgttcggcacggtacgtaccgtgaaaagcggcgat
acggacctctccaacggcggcaagattcgcttgcgcgacgccaacggcaaccccaccgtc
atcaccctcaccatcgtgtga

DBGET integrated database retrieval system