KEGG   Bifidobacterium longum subsp. infantis 157F: BLIF_1293Help
Entry
BLIF_1293         CDS       T01420                                 

Definition
(GenBank) conserved hypothetical protein
Organism
blf  Bifidobacterium longum subsp. infantis 157F
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: BAJ71433
UniProt: E8MUI9
LinkDB All DBs
Position
1496752..1497273
Genome map
AA seq 173 aa AA seqDB search
MSTPEFVLELRKKIGHDLLWLNGVTGCVLNEHGQLLLGRRSDTGEWAMVYGINEPGEQPA
DTVVREIKEETGIDALVTDLVAVTSSDKVLTYANGDNTMYMDHSFLCALKPGGNAEPFVG
DEESLSVGWFDLDDLPTPLAASTSERLELFHTYIENKKHGDAHALFQFDGQQY
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgtccactccggaatttgtgttggaattgcgtaagaagatcggccatgatctgttgtgg
ctcaatggcgtgaccggttgtgtactgaacgaacatggtcaactgctgttgggccgtcgt
tcggacacgggcgaatgggcgatggtctatggcatcaacgagccgggcgaacagccggcg
gacacggtggtgcgcgaaatcaaggaggaaacgggcatcgatgccctcgtcaccgatttg
gtggccgtcacctcgtcagacaaggtgctgacctacgccaatggcgacaacaccatgtac
atggatcattcgttcctgtgcgccctgaagcccggcggcaatgccgaaccattcgtgggc
gacgaggaaagcctgagcgtcggttggttcgatctggatgacctgcccactcccctggcg
gccagcacgagcgagcggctggagctgttccatacttacatcgagaacaaaaagcacggc
gacgcccacgccctgttccagttcgatgggcagcagtactag

DBGET integrated database retrieval system