KEGG   Bifidobacterium longum subsp. longum F8: BIL_09720Help
Entry
BIL_09720         CDS       T02580                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
blg00340  Histidine metabolism
blg01100  Metabolic pathways
blg01110  Biosynthesis of secondary metabolites
blg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BIL_09720
Enzymes [BR:blg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BIL_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: CBK70512
UniProt: D6DDE1
LinkDB All DBs
Position
complement(1147315..1147578)
Genome map
AA seq 87 aa AA seqDB search
MKTFESLFAELSEKAQTRPEGSLTVDELDKGTHFIGKKIIEEAGETWMAAEYEGADRTAE
EMSQLLYHVQVMMIKHGLTLEDVYKHL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtttgaatccctgttcgccgaactgtccgaaaaggcccagacccgccccgaa
ggctccctgaccgtcgacgagctcgacaagggcacccacttcatcggcaagaagatcatc
gaagaggccggcgagacctggatggccgccgaatacgagggtgcggaccgcaccgccgag
gaaatgagccagctgctctaccacgtccaggtcatgatgatcaagcacggcctgacgctt
gaggacgtctacaagcacctgtga

DBGET integrated database retrieval system