KEGG   Bacillus paralicheniformis: BaLi_c00880Help
Entry
BaLi_c00880       CDS       T02694                                 

Gene name
hslO
Definition
(GenBank) disulfide bond chaperone HslO
  KO
K04083  molecular chaperone Hsp33
Organism
blh  Bacillus paralicheniformis
Brite
KEGG Orthology (KO) [BR:blh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:blh03110]
    BaLi_c00880 (hslO)
Chaperones and folding catalysts [BR:blh03110]
 Heat shock proteins
  HSP33
   BaLi_c00880 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AGN34519
LinkDB All DBs
Position
84125..84994
Genome map
AA seq 289 aa AA seqDB search
MDYLVKAIAYDGKVRAYAANTTETIHEAQRRHNTWPTASAALGRTMTAAVMLGAMLKGED
KLTVKIEGGGPIGAIVADGNAKGDVRGYVSNPHVHFDLNEHGKLDVRRAVGTSGTLSVVK
DLGLRDLFTGQVEIVSGEIGEDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFILQLL
PGTDDETITKLETNLSQVEPISKLIQKGLTPEEVLAAVLGEEPEILETVPVRFTCNCSKE
RFSGGIIGLGKDEIQQMIDEDGQAEAQCHFCNEKYLFTKEELEALRDEI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtgaaagccatcgcatatgacggcaaagtgagagcatatgcagcgaat
acaacagaaacgattcatgaagcccaaagaaggcataacacatggcctaccgcttccgcc
gctttaggaagaacgatgacggcggctgtcatgctcggtgccatgctgaaaggcgaagac
aagcttaccgtcaagattgaaggaggcggacctatcggcgcgattgtcgctgacggaaat
gcaaaaggagatgtcaggggctacgtgtccaatccgcacgttcattttgacttaaatgaa
cacggcaaactggacgtcagaagagccgtcggtacgtccggcacactaagcgtagtaaaa
gatctcggtctccgcgatttatttacaggccaggttgagatcgtttccggagaaatcggc
gaggattttacatattatctcgtatcttctgaacaggttccttcttcggtgggggtaggg
gtgctcgtcaaccccgacaatacgattttagctgcaggcggatttatccttcagctgctg
ccgggcacggacgatgaaacaatcacgaagcttgaaacaaacctttctcaagtggagccc
atttcaaagctgattcagaaaggtttgacacctgaggaagtgctggctgcggtattggga
gaagaaccggaaatactggaaaccgttcctgtccggtttacatgcaattgttcaaaagag
cgtttctcaggaggcatcatcggtcttggcaaagatgaaattcaacagatgattgatgaa
gatggccaagctgaggctcaatgccatttttgcaatgaaaagtatctgtttacaaaggaa
gagcttgaagcgcttcgagatgaaatataa

DBGET integrated database retrieval system