KEGG   Bacillus paralicheniformis: BaLi_c05730Help
Entry
BaLi_c05730       CDS       T02694                                 

Gene name
alrA
Definition
(GenBank) D-alanine racemase AlrA
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00473  D-Alanine metabolism
blh01100  Metabolic pathways
blh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BaLi_c05730 (alrA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BaLi_c05730 (alrA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blh01011]
    BaLi_c05730 (alrA)
Enzymes [BR:blh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BaLi_c05730 (alrA)
Peptidoglycan biosynthesis and degradation proteins [BR:blh01011]
 Precursor biosynthesis
  Racemase
   BaLi_c05730 (alrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGN34983
LinkDB All DBs
Position
577964..579136
Genome map
AA seq 390 aa AA seqDB search
MMSLKPFYRKTWAEIDLTALKENVRNMKRHIGEHVHLMAVVKANAYGHGDAQVAKAALAE
GASILAVALLDEALSLRAQGIEEPILVLGAVPPEYASIAAEKRITVTGYSAGWLQDVLGF
LGETEAALEYHLKIDTGMGRLGCKTEEEIKEMMEMTESSDKLNCTGVFTHFATADEKDTD
YFDMQLDRFKELISPLPLDRLMVHSSNSAAGLRFREQLFNAVRFGIGMYGLAPSTEIKDE
LPFRLREVFSLHTELTHVKKIKKGESVSYGATYTAKRDEWIGTVPVGYADGWLRRLAGTE
VLIDGKRQKIAGRICMDQFMISLAEEYPVGTKVTLIGKQKDEWISVDEIAQHLQTINYEI
TCMISSRVPRMFLENGSIMEIRNPILPDQS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcttaaaaccattctatagaaagacatgggccgaaatcgatttaacggcttta
aaagaaaacgtgcgcaatatgaagcggcacatcggtgagcatgtccacttgatggccgtc
gttaaagcgaatgcctacggacacggggatgcacaggtagcgaaggcggctcttgcagaa
ggggcgtccattcttgctgtggctttactggatgaagcgctttcgctgagagcgcagggg
attgaagaaccgattcttgtcctcggtgcagtgccgcccgaatatgcaagcattgccgcg
gaaaagcgcattaccgtgacgggctactccgccggctggctgcaagacgtgctcggtttt
ctcggtgagaccgaagctgctcttgaatatcatttgaagatcgacacgggcatgggccgc
cttggctgcaaaacggaagaagagatcaaagaaatgatggagatgaccgaatcgagcgat
aaactcaattgtacgggcgtgttcactcatttcgcgacggcggacgaaaaggacaccgat
tatttcgacatgcagcttgaccgctttaaagaactgatcagccctctcccgcttgaccgt
ttaatggtgcattcgtcaaacagcgctgcgggtctgcgcttcagggaacagctctttaat
gccgtccgcttcggcatcggcatgtacggtttggcgccgtcaaccgaaataaaagacgag
ctgccgttccgtctgcgggaagtgttttcgcttcataccgaactcacccatgtgaaaaaa
atcaaaaaaggcgagagcgtcagctacggggcgacatatacggccaagcgcgacgaatgg
atcgggacagtccccgtcgggtatgctgacggatggctgaggcgtctggccggaacggaa
gtgctgatcgacggaaaacgccaaaaaatagcagggagaatctgcatggaccagttcatg
atttcccttgccgaagaatatcctgtcggcacaaaggttaccttgatcgggaagcaaaaa
gacgaatggatttcggtcgacgaaatcgcccaacatttgcagacgatcaattatgaaatt
acctgtatgataagttcaagggtgccccgtatgtttttggaaaatgggagtataatggaa
ataaggaatccgatcttgcctgatcaatcctga

DBGET integrated database retrieval system