KEGG   Bacillus paralicheniformis: BaLi_c08520Help
Entry
BaLi_c08520       CDS       T02694                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase YfmT
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00627  Aminobenzoate degradation
blh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BaLi_c08520 (yfmT)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BaLi_c08520 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGN35247
LinkDB All DBs
Position
841293..842750
Genome map
AA seq 485 aa AA seqDB search
MIQITDLNRQYIGGEWRDGQSESVLADLNPFTHKTITSFRKATREDVDAAYKAALEAKKK
WDNVNPYEKRAILEKAAAYIEDNKEAIVYLIMEELGGTRLKAAFEIDLVVNMIKEAAGFP
LKMEGKILPSPVDGKENRIYRIPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEEAGLPEGLLNVVVTDIGEIGDSFVEHPIPRIISFTGSTKVGSYIG
QLAIKHFKKPLLELGGNSALIVLEDADLEYAVNAAAFSRFTHQGQICMSANRILVQKEVY
PEFLKLFSQKISGFKTGDPLDPETVIGPVINERQAEHLRKSIEKGIEEGATPLLKGDIKG
NLVEPTILADVTSDMSVAKEELFGPVVCVMPFETEAEAVEIANDTSFGLSGAVHTGNVER
GVAIAKQIETGMIHVNDTTINDEPHVAFGGEKQSGIGRLNGEWSLDEFTTLKWISVQHQK
RIFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaataactgacctcaaccgtcaatacataggaggggaatggagagacggccaa
agtgaaagcgtcttggccgatctgaatccttttacccataaaacgattacctcttttcgg
aaagcgacgcgggaggatgtcgatgcggcgtacaaagctgcgcttgaggcgaaaaagaaa
tgggataacgtcaatccttatgaaaaaagagcgattttagaaaaagccgcggcttatatt
gaagacaataaagaagcgatcgtgtacctcattatggaggaacttggcggaacacggctg
aaagcggcttttgaaatcgatcttgtcgtcaatatgatcaaagaagcggcaggtttcccg
ctcaaaatggaaggtaaaattctcccttcaccggttgatgggaaagaaaatcggatatac
cgcattccggcgggagtggtcggtgtcatcagtccgttcaactttccgttctttttatct
gtaaaatcggttgcacctgcgcttggcgcagggaacggcgttgtcttaaagccgcatgaa
gaaacaccgatttgcggcggcacgctgattgcaaagatttttgaagaagccggtcttccg
gagggacttctgaatgttgtcgtcacggatatcggggaaatcggcgacagcttcgttgag
cacccgattccgagaatcatctcgtttaccggatcaacgaaggtcggcagctatatcggg
cagctggcgatcaaacattttaaaaaaccgttgcttgaactcggcggaaacagcgcattg
atcgttcttgaggatgccgatttggaatacgctgtcaatgccgcggctttcagccgcttc
acacatcaggggcaaatctgcatgtcggccaaccggattctcgttcaaaaagaagtgtat
ccggaatttttaaagctgttcagccaaaaaatctccgggtttaaaacgggtgatccgctg
gatcctgaaactgtgatcggccctgtcattaatgaacgccaagctgaacatttaagaaaa
tcgattgagaaaggcatcgaagaaggcgccacaccgcttctgaaaggcgatattaaaggc
aatctcgtcgagccgacgattcttgcggatgtcacgtctgacatgtctgtcgccaaggaa
gagctgttcggcccggttgtgtgcgtcatgccgtttgagaccgaagcagaagcggttgag
atcgcgaatgacacttcgttcggactgagcggagccgtacacacgggaaatgtggagcgc
ggcgttgccatcgcgaagcaaatcgagacgggcatgatccatgtcaatgacacaacgatc
aacgacgagccacatgtcgctttcggcggtgaaaagcaatcggggatcggaaggctgaac
ggcgagtggagccttgacgaatttacgacattaaaatggatttccgtccagcaccagaaa
aggatttttccatattaa

DBGET integrated database retrieval system