KEGG   Bacillus paralicheniformis: BaLi_c24490Help
Entry
BaLi_c24490       CDS       T02694                                 

Gene name
yppG
Definition
(GenBank) YppG
Organism
blh  Bacillus paralicheniformis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YppG
Motif
Other DBs
NCBI-ProteinID: AGN36796
LinkDB All DBs
Position
complement(2419076..2419522)
Genome map
AA seq 148 aa AA seqDB search
MEERRTAVYPYSGPGAYVQADQQNHHAYHPVQPYYSQETVPYAHPAQRPQAYQQPIEQNV
DPFSVYHQPVQQQMQPPLPPFQAFPYQHPYPSPRPNLHQPSQFQSFLSQFKKKNGQFDFS
KMMDTAGQMVSTVNQVGALAKGFMGFFK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaggagaaccgccgtatatccttattccggccccggtgcatatgttcaagcc
gatcagcaaaaccatcatgcctatcatcccgttcagccgtactacagccaggaaaccgtc
ccgtacgctcatccagctcagcggccgcaggcctatcagcagccgatcgagcagaatgtg
gacccgttttcagtctatcatcagcctgttcagcagcaaatgcagccgccgcttccgccg
tttcaggcatttccttatcagcatccatatccctcgccgcggccgaatctccaccagcca
tcacagtttcaaagctttctgtcgcaattcaaaaaaaagaacgggcagtttgatttcagc
aaaatgatggacaccgctggccagatggtgagcacggtcaaccaggtcggagcgctggcc
aaagggtttatgggattcttcaaataa

DBGET integrated database retrieval system