KEGG   Bacillus paralicheniformis: BaLi_c29240
Entry
BaLi_c29240       CDS       T02694                                 

Gene name
levG
Definition
(GenBank) fructose-specific phosphotransferase system EIID component LevG
  KO
K02771  fructose PTS system EIID component
Organism
blh  Bacillus paralicheniformis
Pathway
blh00051  Fructose and mannose metabolism
blh02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BaLi_c29240 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BaLi_c29240 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blh02000]
    BaLi_c29240 (levG)
Transporters [BR:blh02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BaLi_c29240 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AGN37270
LinkDB
Position
complement(2905786..2906613)
AA seq 275 aa
MSTEKRLTKKEIFSMFIRSNFLLGSFNFERVQALGYCYVMIPAIKKLYGPGAKRSEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKKIDAKAINGMKIGLMGPLAGVGDPIFWGTL
RPVLAALGASLALSGNIAGPLLFFFLINAIRLSTKYYGLKYGYVKGMEILQDLVGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDDAGKVDVQTVQNILDSIMPGVLPLGL
TLLAAWMLRKGVNPLLMIFGIFIIGIVGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagcacagaaaaaaggttaacgaagaaagagattttcagtatgtttatccgctcaaac
tttttgctcggatcatttaactttgagcgtgtacaggcgctcggctactgctacgtcatg
attccggcgatcaaaaaattgtacggtccgggagcgaaacggagcgaagcgctccagcgc
cacttggaatggtttaatacgcatccgtggctgacagcgccgatattcggcgtgaccgct
gcgatggaagaagaaatggccaacaataaaaagattgatgccaaagcgattaatggaatg
aaaatcggcttaatgggcccgttggcaggtgtgggcgacccgattttctgggggacgctg
cgtcccgttctggcagccttgggagcgtcgcttgctttaagcggaaacatcgccggcccg
cttttgtttttctttttaatcaacgcgatcaggttaagtacaaaatactacgggttaaag
tacggctatgtgaaaggcatggaaattttgcaggacttggtcgggaaccgcattcagaaa
ctgacggaaggcgcttcaatactcgggctgtttgtgatgggagcgctcgtttccaagtgg
acgacgatcaatatcccgatcgtcgtgtcgagaattaaagatgatgcaggcaaagtcgat
gtacagaccgtgcaaaacattttagacagcatcatgccgggggtactgcctctaggattg
acattgctcgctgcctggatgcttcgcaaaggggtgaatcctcttctcatgattttcggt
atttttatcatcgggattgtcggctattgggctggctttttggcataa

DBGET integrated database retrieval system