KEGG   Bacillus paralicheniformis: BaLi_c29250
Entry
BaLi_c29250       CDS       T02694                                 

Gene name
levF
Definition
(GenBank) fructose-specific phosphotransferase system EIIC component LevF
  KO
K11196  fructose PTS system EIIC component
Organism
blh  Bacillus paralicheniformis
Pathway
blh00051  Fructose and mannose metabolism
blh02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BaLi_c29250 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BaLi_c29250 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blh02000]
    BaLi_c29250 (levF)
Transporters [BR:blh02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BaLi_c29250 (levF)
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AGN37271
LinkDB
Position
complement(2906635..2907438)
AA seq 267 aa
MSTIQIILLLVIAAITGIGSVLDEGQTHRPLIACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGVGEGIAVAVALAAAGQALTIFVRTITVFLIH
RADKYAKDGNFKGIEIMHITAMAFQALRVMIPTLIVALISVSAVQAFLGNIPDVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLAFLYQQVMQ
KNHAQGAVAAASDSSVAAYDDDDDLDA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcaacgattcaaattattttgctgctcgtcattgcagctataacaggtatcggtagt
gtattggacgaagggcagacacaccgtccgctgattgcctgcacgttggtcggcctggtt
ctcggggatctgaaaacaggcatcattctcggcggaacgctggagctgatggcgcttggc
tggatgaacgtcggtcttgcaatggcccccgatacggctatcgcttccgtgatttcgacc
attttagtgattaccgccgatcagggagtcggtgaagggattgccgtcgcggtggctttg
gctgctgcgggtcaggcgctgacgattttcgtcaggacgatcaccgtatttttaattcac
cgtgccgacaaatacgcaaaggatggcaattttaaaggaattgaaatcatgcatattacc
gccatggcgtttcaggcgctgcgcgttatgattccgacattgattgtggctctgatcagt
gtcagcgctgttcaggcgtttttgggaaatattccggacgtcatcacaaaaggtttgcaa
ataggcggggggattatcgttgttgtcggatatgcgatggtcatcaacatgatgaacatt
ccgtatttgaagccgtttttctatatcggttttttgctggccgcgtttaccgatttcaat
ttagtcggcttcggtgccctcgggctttgtctggcatttttatatcagcaagtgatgcaa
aaaaatcatgcgcagggggcggtggctgccgccagtgacagcagcgtggctgcatatgat
gatgacgatgatctggatgcttaa

DBGET integrated database retrieval system