KEGG   Bacillus paralicheniformis: BaLi_c29270
Entry
BaLi_c29270       CDS       T02694                                 

Gene name
levD
Definition
(GenBank) fructose-specific phosphotransferase system IIA component LevD
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00051  Fructose and mannose metabolism
blh02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BaLi_c29270 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BaLi_c29270 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blh02000]
    BaLi_c29270 (levD)
Enzymes [BR:blh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BaLi_c29270 (levD)
Transporters [BR:blh02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BaLi_c29270 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AGN37273
LinkDB
Position
complement(2907948..2908385)
AA seq 145 aa
MITVIISGHGNFPTALKESSGMIFGEEDSLIAVPFLKGEGIQTLQEKYHQTLKDIPEEHE
VLFLVDIFGGTPYNAATPYIAKERRFDMAAGVNLPILLEALSLREHMPLKQLLNQLKKMS
RECFQICSEQLEKFSQSNQGREDEL
NT seq 438 nt   +upstreamnt  +downstreamnt
atgattacagtcattatcagcggccacggaaactttcccacagcattaaaagaatcttca
gggatgatattcggagaagaagacagcctgatcgcggtgccgtttctgaaaggggaaggc
attcagacactgcaagaaaaatatcatcagacgctgaaggacattccggaggaacacgag
gtgctttttttagtggatattttcggcgggacgccatacaacgcagcgactccttacatc
gcgaaggagcggagattcgatatggcagccggcgtgaacctgccgattttgttagaggca
ttgagcttgagggagcatatgccgctcaaacaactgctgaaccagttgaaaaagatgagc
cgggaatgcttccaaatctgcagcgagcaattggaaaaattcagtcagtctaatcaggga
agagaggatgaattgtaa

DBGET integrated database retrieval system