KEGG   Bacillus paralicheniformis: BaLi_c31420Help
Entry
BaLi_c31420       CDS       T02694                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00020  Citrate cycle (TCA cycle)
blh00480  Glutathione metabolism
blh01100  Metabolic pathways
blh01110  Biosynthesis of secondary metabolites
blh01120  Microbial metabolism in diverse environments
blh01130  Biosynthesis of antibiotics
blh01200  Carbon metabolism
blh01210  2-Oxocarboxylic acid metabolism
blh01230  Biosynthesis of amino acids
Module
blh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
blh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BaLi_c31420 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BaLi_c31420 (icd)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BaLi_c31420 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGN37486
LinkDB All DBs
Position
complement(3133305..3134621)
Genome map
AA seq 438 aa AA seqDB search
MFFYIEELHIMGGFIVAQGEKITVSGGVLNVPNNPVIPFIEGDGTGPDIWRAASRVLEAA
VEKAYNGEKEITWKEVYAGEKAYNKTGEWLPEETLDTIREYLIAIKGPLTTPVGGGIRSL
NVALRQELDLFTCLRPVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQK
LISFLKNELGVNKIRFPETSGIGIKPVSEEGTSRLVRAAIEYAIEHGRKSVTLVHKGNIM
KFTEGAFKNWGYEVAEKEFGDKVFTWAEYDRIAEKDGKDAANKAQSEAEAAGKIIIKDSI
ADIFLQQILTRPAEFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATH
GTAPKYAGLDKVNPSSVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDG
ATEVKCSEFGDELIKNMS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtttttctatattgaagaattacatattatgggaggttttattgtggcacaaggcgaa
aaaattacagtctccggcggagtattaaacgttccaaacaacccggttatcccgtttatt
gaaggggacggaacaggtcctgatatttggagagcggcttcaagggttcttgaagcggct
gtggagaaagcgtataacggcgaaaaggaaatcacttggaaagaagtctacgccggggaa
aaagcgtacaacaaaacaggcgaatggcttcctgaagaaacgcttgatacgatccgcgaa
tacctgatcgcgattaaaggtcctttaacaactcctgtaggcggcggaatccgctcatta
aacgtagcgctaagacaagagcttgacctgtttacatgcctgcgtcctgtccgctatttc
acaggcgttccttcaccggttaagcgccctgaagatacggatatggtcatcttccgcgaa
aatactgaagatatctatgccggcatcgaatacgcgaaaggctctgaagaagttcaaaag
ctgatttcattcctgaaaaacgagcttggcgttaacaaaatccgtttccctgaaacatca
ggcatcggtatcaagccggtttctgaagaaggaacgtcaaggcttgtcagagctgcgatc
gagtatgcaatcgagcacggccgcaaatctgtaacgctcgtccataaaggaaacatcatg
aaattcacggaaggcgcctttaaaaactggggctatgaagtggctgaaaaagaattcggc
gataaagtattcacatgggccgaatacgaccgcatcgctgaaaaagacggcaaagacgct
gcaaacaaagcgcaaagcgaagctgaagcggccggcaaaatcatcatcaaagacagcatc
gctgacatcttccttcagcagatcctgacccgccctgccgagtttgatgttgtggcgaca
atgaacctgaacggggactacatttcagatgcgcttgctgcccaagtcggcggaatcggc
atcgctcctggagcaaacatcaactatgagacaggacacgccatctttgaagcgacacat
ggtacagctccaaaatatgctggcctagacaaagtaaacccgtcttcagtcatcctatcc
ggcgtgctgcttcttgagcatttgggctggaatgaagctgccgaccttgtgattaaatct
atggagaaaacaatcgcatccaaagtcgtcacatacgatttcgctcgtttgatggacggc
gcgactgaagttaaatgctctgaattcggtgatgagcttatcaaaaatatgtcttaa

DBGET integrated database retrieval system