KEGG   Bacillus paralicheniformis: BaLi_c31490Help
Entry
BaLi_c31490       CDS       T02694                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
blh  Bacillus paralicheniformis
Pathway
blh00010  Glycolysis / Gluconeogenesis
blh00030  Pentose phosphate pathway
blh00051  Fructose and mannose metabolism
blh00052  Galactose metabolism
blh00680  Methane metabolism
blh01100  Metabolic pathways
blh01110  Biosynthesis of secondary metabolites
blh01120  Microbial metabolism in diverse environments
blh01130  Biosynthesis of antibiotics
blh01200  Carbon metabolism
blh01230  Biosynthesis of amino acids
blh03018  RNA degradation
Module
blh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
blh_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:blh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BaLi_c31490 (pfkA)
   00030 Pentose phosphate pathway
    BaLi_c31490 (pfkA)
   00051 Fructose and mannose metabolism
    BaLi_c31490 (pfkA)
   00052 Galactose metabolism
    BaLi_c31490 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    BaLi_c31490 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BaLi_c31490 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:blh01009]
    BaLi_c31490 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:blh03019]
    BaLi_c31490 (pfkA)
Enzymes [BR:blh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BaLi_c31490 (pfkA)
Protein phosphatases and associated proteins [BR:blh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BaLi_c31490 (pfkA)
Messenger RNA biogenesis [BR:blh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BaLi_c31490 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AGN37493
LinkDB All DBs
Position
complement(3141876..3142835)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKYGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDLTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAESILIPEADYDMEEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEATNL
ETRVSVLGHIQRGGSPTAADRVLASRLGAFAVELLLEGKGGRCVGIQNNQLVHHDIIEIL
DHKHTIDQSMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatcggagtattgacgagcggcggagattccccgggaatgaacgcggcggtc
cgcgcggttgtcaggaaagcaatctaccatgacgtagaagtatacggaatttacaacggg
tattcaggtttaatcagcggaaaaatagaaaagcttgaaatcggttctgtcggagatatc
attcaccgcggaggaacgaagctatatacagcaaggtgtcctgagtttaaaacggtagaa
ggacgggaaaaaggaatagcgaatttaaaaaaatatggtatagaaggattagtcgtcatt
ggcggagacggttcttatatgggagcgaaaaagctgacagaacacggttttccttgtgtc
ggagtgccgggaacaatcgacaatgacatccctggaacagatttgacgatcggatttgat
acggcgttaaataccgttatcgatgccatcgataaaatcagggatacagctacatcccac
gaacgtacatacgtgattgaagtaatgggccgccatgccggggacattgctttatggtca
ggtttggcaggaggcgcggaatccattttgatccctgaagctgactacgatatggaagaa
attattgcgaggctgaaaagagggcatgagcgcggcaaaaaacacagcatcatcattgtg
gcggaaggcgtcggaagcggcgttgaattcggcaaaagaattgaagaagccacaaatctc
gaaactagagtatcggtgcttggacatatccagcgcggcggttctccgactgcagcagac
cgtgtattggcaagccgtctaggggcatttgcggttgaactgcttcttgaaggaaaaggc
ggacgctgtgtcggaattcaaaataaccagcttgtgcatcatgatatcattgaaatactc
gatcataaacatacaattgatcaaagcatgtaccgcttgtctcaagaactgtcaatctag

DBGET integrated database retrieval system