KEGG   Bacillus paralicheniformis: BaLi_c35500Help
Entry
BaLi_c35500       CDS       T02694                                 

Gene name
yvzF
Definition
(GenBank) YvzF
Organism
blh  Bacillus paralicheniformis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3970 Sec7 RRM_3
Motif
Other DBs
NCBI-ProteinID: AGN37865
LinkDB All DBs
Position
complement(3521258..3521425)
Genome map
AA seq 55 aa AA seqDB search
MAQIRLTGKPEEIERIIQSFSKHYEVSYVSKEYGKTNPKYKYAKDSRVYIELKLK
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcagatcaggcttacggggaaaccggaagagattgaacgcattatccaatctttt
tctaagcattatgaggtttcatatgtatcgaaagaatacggcaagacaaacccgaaatat
aaatatgcaaaagattcccgagtttatattgagctaaaattaaaataa

DBGET integrated database retrieval system