KEGG   Bacillus paralicheniformis: BaLi_c37310Help
Entry
BaLi_c37310       CDS       T02694                                 

Gene name
yvcI
Definition
(GenBank) putative Nudix family hydrolase YvcI
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
blh  Bacillus paralicheniformis
Brite
KEGG Orthology (KO) [BR:blh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:blh03400]
    BaLi_c37310 (yvcI)
Enzymes [BR:blh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BaLi_c37310 (yvcI)
DNA repair and recombination proteins [BR:blh03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BaLi_c37310 (yvcI)
 Prokaryotic Type
    BaLi_c37310 (yvcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX SH3_1
Motif
Other DBs
NCBI-ProteinID: AGN38045
LinkDB All DBs
Position
complement(3712943..3713407)
Genome map
AA seq 154 aa AA seqDB search
MQRVTNCVLTSGDKVLLLQKPRRGWWVAPGGKMESGETVRDAVIREYREETGLYVLNPQL
KGIFTFIIKENDQVVSEWMMFTFVADHYTGKHVEESEEGIIRWHQAGDVGSLPMAPGDVH
ILDFMLKGKGLLHGTFTYTPDFELLSYRLDPQGE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagagtgacgaattgtgtgctgacttcaggtgataaagtcctgttgctgcaaaag
cccagacgaggctggtgggtagcccccggcggtaaaatggaaagcggggaaaccgtcagg
gacgccgtcatcagggaataccgcgaagagacgggtctgtatgtgctgaacccgcagctg
aaagggatattcacctttatcataaaagaaaatgatcaggtcgtatctgaatggatgatg
ttcacattcgtcgccgatcattatacaggtaaacatgtagaagaatcggaagaaggcatc
atcaggtggcatcaggcgggagacgtcgggagcctgccgatggcgccgggagacgtccat
attctggattttatgctgaaaggcaaaggactgcttcacggcacctttacgtatacgcct
gactttgaattgctgtcctatcgcctcgacccgcaaggcgaataa

DBGET integrated database retrieval system