KEGG   Bacillus paralicheniformis: BaLi_c42860Help
Entry
BaLi_c42860       CDS       T02694                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase large subunit AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
blh  Bacillus paralicheniformis
Brite
KEGG Orthology (KO) [BR:blh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BaLi_c42860 (ahpF)
Enzymes [BR:blh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BaLi_c42860 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C DAO Thi4 FAD_binding_3 Glutaredoxin NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AGN38598
LinkDB All DBs
Position
4304795..4306324
Genome map
AA seq 509 aa AA seqDB search
MVLEANIKAQLNQYMQMIENDIVLKVSTGDDSVSKDMLALVEELASMSSKITVEKAQLDR
TPSFSVNRAGEETGVTFAGVPLGHEFTSLVLALLQVSGRPPKVDQKIIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKSEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASELSDKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVKRTEGPKLAASLEEHVKDYEIDVMNLQRAKGLEKKDLFHLELE
NGAVLKSKTVILSTGARWRNIGVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDENVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLPETVERNRIGEIAVDKRGETTIPGLFAAGDC
TDGPYNQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgaagcaaatatcaaagcacaattaaaccaatacatgcagatgattgaaaat
gacatcgtccttaaagtcagtacaggcgatgacagtgtctctaaggatatgctggctctt
gtagaagagctggcttccatgtcatcaaaaatcactgttgaaaaggcgcagctcgacaga
acgccaagcttcagcgtcaatcgtgccggagaagaaacaggcgtcacattcgccggagtt
ccgctcggtcacgaattcacatctttggtgctggcactcttgcaagtaagcggccgaccg
ccgaaagtcgatcaaaaaatcatcgatcaaatcaagaacatcagcggcgaataccgcttc
gaatcttatatcagcctcacatgccacaactgcccggacgttgtgcaggcattgaacatg
atgagcgtgctcaacccgaacatcacgcacacgatgatcgatggtgcggcatacaagtca
gaagtcgaaagcaaaaacattatggctgtgccgaccgtatacttaaacggcgaatccttt
ggaagcggccgaatgacgcttgaagaaattcttgcgaaaatgggcagcggcacagatgca
tctgagctttctgataaagatccgttcgatgtactcgttgtcggaggcggacctgccggt
gcaagcgcagcaatctatgcggcgcgcaaaggcatccgcacaggaatcgttgccgaacgc
ttcggcggccaagtccttgacacgatgagcatcgagaacttcatcagcgtgaagcgcacc
gaagggccgaagcttgcggcaagccttgaagaacacgtgaaggattacgagatcgacgtc
atgaacctgcaacgcgcaaaaggtctcgagaaaaaagatcttttccatcttgaactcgaa
aacggagctgttctgaaaagcaaaaccgtcattctgtcaactggcgcacgctggcgcaat
atcggcgtacctggcgaacaagagttcaaaaacaaaggtgtcgcatactgccctcactgt
gacggaccgttgtttgaaggcaaagacgtcgccgtcatcggcggcggaaactccggtatc
gaagcagcgattgaccttgcaggtatcgtcaaccacgtgactgttcttgagttcgcaccg
gagctgaaagcagacgaagttctgcaaaaacgtctctacagtctccctaacgtgactgtc
gtgaaaaacgcccaaacaaaagaaatcacgggtgatgaaaacgtaaacggcatcacttac
gttgaccgtgaaacaggagaagaaaaacacgtcgagctccaaggcgtcttcgtccaaatc
ggtcttgtgccgaacacggaatggctccctgaaaccgtcgaacgcaaccgcatcggcgaa
attgcagtcgacaaacgcggcgaaacaaccatccctggcctattcgctgccggcgactgc
acagacggaccatataaccaaatcattatttcaatgggatcgggggcaaatgccgcatta
ggggcgtttgattatttgatccggaactaa

DBGET integrated database retrieval system