KEGG   Bacillus licheniformis ATCC 14580: BL00201Help
Entry
BL00201           CDS       T00197                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase (large subunit) and NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
KEGG Orthology (KO) [BR:bli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BL00201 (ahpF)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BL00201 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C DAO Thi4 NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin FANCI_S3
Motif
Other DBs
NCBI-ProteinID: AAU25727
UniProt: Q65CV9
LinkDB All DBs
Position
4141402..4142931
Genome map
AA seq 509 aa AA seqDB search
MVLEANIKAQLNQYMQMIENDIVLKVSAGDDSVSKDMLALVEELASMSSKITVEKAQLDR
TPSFSVNRAEEDTGVTFAGVPLGHEFTSLVLALLQVSGRPPKVDQKIIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNISHTMIDGAAYKSEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASELSDKEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFISVKRTEGPKLAASLEEHVKDYDIDVMNLQRAKGLEKKDLFHLELE
NGAVLKSKTVILSTGARWRNIGVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADKVLQKRLYSLPNVTVVKNAQTKEITGDENVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLPETVERNRIGEIAVDKRGETTIPGLFAAGDC
TDSPYNQIIISMGSGANAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgaagcaaatatcaaagcacaattaaaccaatacatgcagatgattgaaaat
gacatcgtccttaaagtcagtgcaggcgatgacagtgtctctaaggatatgctggctctt
gtagaagagctggcttccatgtcatcaaaaatcactgttgaaaaggcgcagctcgacaga
acgccaagcttcagcgtcaatcgtgccgaagaagatacaggcgtgacattcgccggggtt
ccgctcggtcacgaattcacatctttggtgctggcactcttgcaagtaagcggcagaccg
ccgaaagtcgatcaaaaaatcatcgatcaaatcaagaacatcagcggcgagtaccgcttc
gaatcttatatcagcctcacatgccacaactgcccggatgttgtgcaggcattgaacatg
atgagcgtgctcaacccgaacatctctcacacaatgatcgacggtgcggcatacaagtca
gaagtcgaaagcaaaaacattatggctgtgccgaccgtatacttgaacggcgaatccttt
ggaagcggccgaatgacgcttgaagaaattcttgcgaagatgggcagcggcacagatgcg
tctgagctttctgataaagaaccgttcgatgtactcgttgtcggaggcgggcctgccggc
gccagcgcagcaatctatgcggcgcgcaaaggcatccgtacgggaatcgttgccgaacgc
ttcggcggccaagtccttgacacgatgagcatcgagaacttcatcagcgtgaagcgcacc
gaagggcctaagcttgcggcaagccttgaagaacacgtgaaggattatgatatcgacgtc
atgaacctgcaacgagcaaaaggcctcgagaaaaaagaccttttccatctagaactcgaa
aacggcgctgttctgaagagcaaaaccgtcattctttcaactggcgcacgctggcgcaat
atcggcgtacccggcgaacaagagttcaaaaacaaaggtgtcgcatactgccctcactgt
gacggaccattgtttgaaggcaaagacgtcgccgtcatcggcggcggcaactccggcatc
gaagcggcgattgaccttgcaggcatcgtcaaccatgtgactgttcttgagtttgcgccg
gagctgaaagcagacaaagttctgcaaaaacgtctctacagcctccccaacgtgactgtc
gtgaaaaacgcccaaacaaaagaaatcacgggcgatgaaaacgtaaacggcattacttac
gtagaccgtgaaacaggagaagaaaaacacgtcgagctccaaggcgtcttcgtccaaatc
ggtcttgtgccgaacacggaatggctgcctgaaaccgtcgaacgcaaccgcatcggcgaa
atcgcagtcgacaaacgcggcgaaacaaccatccctggattgttcgctgccggcgactgc
acagacagcccgtacaaccaaatcatcatttccatgggatccggagcaaacgctgcttta
ggcgcgtttgactacctgattcggaattaa

DBGET integrated database retrieval system