KEGG   Bacillus licheniformis ATCC 14580: BL00398Help
Entry
BL00398           CDS       T00197                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00020  Citrate cycle (TCA cycle)
bli00480  Glutathione metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
bli01210  2-Oxocarboxylic acid metabolism
bli01230  Biosynthesis of amino acids
Module
bli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bli_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BL00398 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BL00398 (icd)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BL00398 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AAU24567
UniProt: A5A658
LinkDB All DBs
Position
complement(2947154..2948425)
Genome map
AA seq 423 aa AA seqDB search
MAQGEKITVSGGVLNVPNNPVIPFIEGDGTGPDIWRAASRVLEAAVEKAYNGEKKITWKE
VYAGEKAYNKTGEWLPEETLDTIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLKNELGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EKEFGDKVFTWAEYDRIAEKDGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGDELIK
NMS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaggcgaaaaaattacagtctccggcggagtattaaacgttccaaacaacccg
gtcatcccgtttattgaaggggacggaacaggtcctgatatttggagagcggcttccagg
gttcttgaagcggctgtggagaaagcgtataacggcgaaaagaaaatcacttggaaagaa
gtctacgccggggaaaaagcgtacaacaaaaccggcgaatggcttccggaagaaacgctt
gatacgatccgcgaatacctgatcgcgattaaaggtcctttaacaactcctgtaggcggg
ggaatccgctcattaaacgtagcgctcagacaagagcttgacttgtttacatgcctgcgt
cctgtccgctatttcacaggcgttccttcaccggttaagcgccctgaagatacggacatg
gtcatcttccgtgagaatactgaagatatctacgccggcatcgagtacgcgaaaggctct
gaagaagtgcaaaagctgatttcattcctgaaaaacgagcttggcgttaacaaaatccgc
ttccctgaaacatcgggcatcggcatcaagccggtttctgaagaaggaacatcaaggctt
gtcagagctgcgatcgagtatgcgatcgagcacggccgcaaatctgtgacgctcgtccat
aaaggaaacatcatgaaattcacggaaggcgcctttaaaaactggggctatgaagtggct
gaaaaagaattcggcgataaagtattcacttgggccgaatacgaccgcatcgctgaaaaa
gacggcaaagacgctgcaaacaaagcgcaaagcgaagctgaagctgccggcaaaatcatc
atcaaagacagcatcgccgacatcttcctgcagcagattctgacacgtcctgccgagttt
gacgttgtggcgacaatgaacctgaacggggactacatttcagatgcgctggctgcccaa
gtcggcggaatcggcatcgcacctggagcaaacatcaactatgagacaggacatgccatc
tttgaggcgacacatggtacagcgcctaaatacgccggcctcgacaaagtaaacccgtct
tcagtcatcctatccggcgtgctgcttcttgagcatttgggctggaatgaggcggccgac
cttgtcattaaatcaatggagaaaacaatcgcatccaaagtcgtcacatacgatttcgct
cgtttgatggacggcgcgactgaagtcaaatgctctgaattcggtgatgagcttatcaaa
aacatgtcttaa

DBGET integrated database retrieval system