KEGG   Bacillus licheniformis ATCC 14580: BL00499Help
Entry
BL00499           CDS       T00197                                 

Gene name
amyL
Definition
(GenBank) alpha amylase, Glycoside Hydrolase Family 13
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00500  Starch and sucrose metabolism
bli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL00499 (amyL)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BL00499 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AAU22245
UniProt: Q65MX0
LinkDB All DBs
Structure
PDB: 

Position
657584..659122
Genome map
AA seq 512 aa AA seqDB search
MKQQKRLYARLLPLLFALIFLLPHSAAAAANLKGTLMQYFEWYMPNDGQHWKRLQNDSAY
LAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRTKYGTKGELQSAIKSLH
SRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHRIKAWTHFHFPGRGSTYS
DFKWHWYHFDGTDWDESRKLNRIYKFQGKAWDWEVSNENGNYDYLMYADIDYDHPDVAAE
IKRWGTWYANELQLDGFRLDAVKHIKFSFLRDWVNHVREKTGKEMFTVAEYWQNDLGALE
NYLNKTNFNHSVFDVPLHYQFHAASTQGGGYDMRKLLNGTVVSKHPLKAVTFVDNHDTQP
GQSLESTVQTWFKPLAYAFILTRESGYPQVFYGDMYGTKGDSQREIPALKHKIEPILKAR
KQYAYGAQHDYFDHHDIVGWTREGDSSVANSGLAALITDGPGGAKRMYVGRQNAGETWHD
ITGNRSEPVVINSEGWGEFHVNGGSVSIYVQR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaaaaacggctttacgcccgattgctgccgctgttatttgcgctcatcttc
ttgctgcctcattctgcagcagcggcggcaaatcttaaagggacgctgatgcagtatttt
gaatggtacatgcccaatgacggccaacattggaagcgcttgcaaaacgactcggcatat
ttggctgaacacggtattactgccgtctggattcccccggcatataagggaacgagccaa
gcggatgtgggctacggtgcttacgacctttatgatttaggggagtttcatcaaaaaggg
acggttcggacaaagtacggcacaaaaggagagctgcaatctgcgatcaaaagtcttcat
tcccgcgacattaacgtttacggggatgtggtcatcaaccacaaaggcggcgctgatgcg
accgaagatgtaaccgcggttgaagtcgatcccgctgaccgcaaccgcgtaatttcagga
gaacaccgaattaaagcctggacacattttcattttccggggcgcggcagcacatacagc
gattttaaatggcattggtaccattttgacggaaccgattgggacgagtcccgaaagctg
aaccgcatctataagtttcaaggaaaggcttgggattgggaagtttccaatgaaaacggc
aactatgattatttgatgtatgccgacatcgattatgaccatcctgatgtcgcagcagaa
attaagagatggggcacttggtatgccaatgaactgcaattggacggtttccgtcttgat
gctgtcaaacacattaaattttcttttttgcgggattgggttaatcatgtcagggaaaaa
acggggaaggaaatgtttacggtagctgaatattggcagaatgacttgggcgcgctggaa
aactatttgaacaaaacaaattttaatcattcagtgtttgacgtgccgcttcattatcag
ttccatgctgcatcgacacagggaggcggctatgatatgaggaaattgctgaacggtacg
gtcgtttccaagcatccgttgaaagcggttacatttgtcgataaccatgatacacagccg
gggcaatcgcttgagtcgactgtccaaacatggtttaagccgcttgcttacgcttttatt
ctcacaagggaatctggataccctcaggttttctacggggatatgtacgggacgaaagga
gactcccagcgcgaaattcctgccttgaaacacaaaattgaaccgatcttaaaagcgaga
aaacagtatgcgtacggagcacagcatgattatttcgaccaccatgacattgtcggctgg
acaagggaaggcgacagctcggttgcaaattcaggtttggcggcattaataacagacgga
cccggtggggcaaagcgaatgtatgtcggccggcaaaacgccggtgagacatggcatgac
attaccggaaaccgttcggagccggttgtcatcaattcggaaggctggggagagtttcac
gtaaacggcgggtcggtttcaatttatgttcaaagatag

DBGET integrated database retrieval system