KEGG   Bacillus licheniformis ATCC 14580: BL00854Help
Entry
BL00854           CDS       T00197                                 

Gene name
hslO
Definition
(GenBank) putative chaperone protein HslO
  KO
K04083  molecular chaperone Hsp33
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
KEGG Orthology (KO) [BR:bli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bli03110]
    BL00854 (hslO)
Chaperones and folding catalysts [BR:bli03110]
 Heat shock proteins
  HSP33
   BL00854 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AAU21719
UniProt: Q65PF0
LinkDB All DBs
Position
84680..85549
Genome map
AA seq 289 aa AA seqDB search
MDYLVKAIAYDGKVRAYAANTTETIHEAQRRHNTWPTASAALGRTMTAAVMLGAMLKGED
KLTVKIEGGGPIGAIVADGNAKGDVRGYVSNPHVHFDLNEHGKLDVRRAVGTSGTLSVVK
DLGLRDLFTGQVEIVSGEIGEDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFILQLL
PGTDDETITKLETNLSQVEPISKLIQKGLTPEEVLAAVLGEEPEVLETVPVRFTCNCSKE
RFARGIIGLGKDEIQQMIDEDGQAEAQCHFCNETYLFTKEELEALRDEI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtgaaagccattgcatatgacggcaaagtgagggcatatgcagcgaat
acaacagaaacgattcatgaagcccaaagaaggcataacacatggcctaccgcttccgcc
gctttaggaagaacgatgacggcggctgtcatgctcggcgccatgctgaaaggcgaagac
aagctcaccgttaagattgaaggaggcggaccgatcggcgcgattgtcgctgacggaaat
gcaaaaggagacgtcaggggatacgtgtccaatccgcacgttcatttcgacttaaatgaa
cacggcaaacttgacgtcagaagagccgtcggtacgtcaggaacgctaagcgtagtaaaa
gatctcggtctccgcgatttatttacaggccaggttgagatcgtttccggagaaatcggc
gaggattttacttattatctcgtgtcctctgaacaggttccttcttcggtgggtgtaggg
gtgctcgtcaaccccgacaatacgattttagctgcaggcggatttatcctgcagctgctg
ccgggaacggacgacgaaaccatcacgaagcttgaaacaaacctttcacaagtggagcca
atttcaaagctgattcagaaaggtttgacacctgaggaagtgctggctgcggtattggga
gaagaaccggaagtactggaaaccgttcctgtccgatttacatgcaattgttcaaaagaa
cgtttcgcaagaggcatcatcggtcttggcaaggatgaaattcaacagatgattgatgaa
gatggccaagccgaggctcaatgccatttttgcaatgaaacgtatctgtttacaaaggaa
gagcttgaagcgcttcgagatgaaatataa

DBGET integrated database retrieval system