KEGG   Bacillus licheniformis ATCC 14580: BL01769Help
Entry
BL01769           CDS       T00197                                 

Gene name
nasD
Definition
(GenBank) assimilatory nitrite reductase (subunit)
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00910  Nitrogen metabolism
bli01100  Metabolic pathways
bli01120  Microbial metabolism in diverse environments
Module
bli_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BL01769 (nasD)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     BL01769 (nasD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Rubredoxin_C Pyr_redox_3 NIR_SIR_ferr HI0933_like AlaDh_PNT_C NAD_binding_7 3HCDH_N GIDA FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAU22083
UniProt: Q65NC4
LinkDB All DBs
Position
489963..492383
Genome map
AA seq 806 aa AA seqDB search
MKKKQLVLVGNGMAGVRAIEEILKISNEEFQITIFGSEPHPNYNRILLSKVLQGDTDVKD
ITLNDWDWYEENGIQLYTGEEVVKVDPESKTVITDTGRVQPYDELILATGSLPFILPLPG
ADKEGVTAFRDIKDTDIMLEASKTYKKAAVIGGGLLGLEAARGLLNLGMDVTVVHLAPYL
MERQLDAAAGRLLQKELEKQGMKFLLEKQTEEIYGETRVEGLKFKDGSTLEADLVVMAVG
IKPNVQLGKDCGLPVNRGIVVNDYMETEVPNIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KKICGVETAPYEGSVLSTQLKVSGVEVFSAGDFNEDDGEDKKALKVFDEQDGIYKKIVLR
GNQVIGAVLFGDSSEGNRLFSMIQKGADISDTSKISILQPLNQEEGMSLTAAMSDDEIVC
GCNGVSKGMIIQAIKEQGCTSTDEIKACTGASRSCGGCKPLVAEILQHTLGSEFDASAQK
EAICGCTDLSRDELVAEIREKGLTHTKEVMNVLGWKTAEGCSKCRPALNYYLGMINPKEY
EDERESRFVNERMHANIQKDGTYSVVPRMYGGVTNSNDLRRIADVVDKYEIPLVKMTGGQ
RIDLIGVKKEDLPKVWADLDMPSGFAYGKTLRTVKTCVGEQFCRFGTQDSMALGIDLEKK
FEGLYTPHKIKMAVSACPRNCAESGIKDIGVVGIDGGWEIYVGGNGGTHLRAGDLLMKVK
TAEEVIEITGAYLQYYRETANYLERTSAWIERVGLSHVQSVLNDKEKRKELNDRINQALS
VHKDPWKDFLEDGKTTRQLFENVVTS
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaaagcagcttgtccttgtagggaacggtatggccggggtcagggccattgaa
gaaattcttaaaatttcaaacgaagagtttcagatcacgattttcggcagcgaaccgcac
ccaaactataaccggattcttctttccaaagtgcttcaaggagatacggatgttaaggac
attacactgaatgattgggattggtatgaagaaaacggcattcagctgtatacaggtgaa
gaagtcgttaaagttgatccggagtccaaaaccgtcatcacggatacgggaagagtccag
ccgtatgatgaactgattttggcgacaggttctctcccttttattctgccattgcccgga
gcggataaagaaggtgtaacagctttccgtgatatcaaggatacggatatcatgctcgaa
gcttccaaaacgtacaaaaaagcagcagttatcggcggcgggctgctgggactggaagca
gcgcgcggacttctcaaccttggcatggatgttaccgttgtccacctcgcgccatatttg
atggagcgtcagcttgatgcagccgcaggacggcttttgcaaaaagagctggaaaagcag
ggcatgaaatttttactggaaaagcagaccgaagaaatttacggagaaacacgtgtcgaa
ggcttaaaattcaaagacggctcaacgcttgaggccgatttggtcgtcatggcggtcgga
atcaagccgaacgttcagctcggcaaagactgcggccttccggtaaacagaggaatcgtc
gtcaatgattacatggagaccgaagttcccaacatttacgctgtcggagaatgcgcggag
cataggggcattgcctacggacttgtcgcgcctctttatgaacaggcaaaagtgcttgcc
aaaaaaatctgcggcgttgaaacggctccgtatgaaggatctgttttatctacccagctg
aaggtttccggtgttgaggtcttttctgccggtgactttaatgaggatgacggagaagac
aaaaaagcgctcaaagtgtttgacgaacaggacggaatctacaaaaaaatcgttctgcgc
ggcaatcaggtgatcggcgccgtactgttcggagacagcagcgaaggaaacaggctgttt
tccatgattcaaaaaggagcggatatttctgatacttcaaaaatttcaatcttgcagcct
ttgaatcaggaagaaggcatgagcttgaccgctgcgatgagcgacgatgagatcgtgtgc
ggctgcaacggcgtttcgaaaggaatgatcattcaggcgatcaaagagcagggatgcaca
tcgacggatgaaattaaagcatgcacaggcgcatcgcgctcttgcggaggatgtaagccg
cttgtcgcagagattctccagcatacgctcggctcagaatttgatgcttcagcacaaaaa
gaagcgatttgcggatgtacggacctttcaagagacgaactcgtggccgaaatcagagaa
aaagggctgacccatacaaaagaagtcatgaacgtgctcggctggaaaacggcggaaggc
tgttccaaatgccgccctgcgcttaactactacctcggcatgatcaatccgaaggaatat
gaagatgaaagagaatcccgcttcgtcaatgaacggatgcacgccaacattcaaaaagac
ggcacatattcagtcgtaccgcggatgtacggcggggtcaccaattcgaatgacttgcgg
cgcatcgccgatgtcgtcgacaaatatgaaattcctctagtgaaaatgaccggcggccag
cggatcgatctgatcggcgtcaaaaaagaggatcttccgaaagtatgggctgatcttgac
atgccttctggatttgcttacggaaaaacgctcagaaccgtaaaaacgtgcgtaggcgaa
cagttctgccgcttcggaacgcaagattcaatggctctcggaattgaccttgagaaaaaa
tttgaagggctctacacgcctcacaaaattaaaatggcggtttccgcttgtccgagaaac
tgtgctgaatccggcattaaagatatcggcgttgtcggcatcgacggcggctgggaaatt
tacgtcggcggaaacggaggcacacatctgcgtgcaggcgatctgttaatgaaagtcaaa
acggctgaagaagtcatcgaaatcacaggcgcatatctccaatactatcgtgaaacagcc
aactatttagagcggacatctgcatggatcgaacgtgtcggcttgtcccacgtccaatcc
gtattgaatgataaagaaaaacgcaaagagctgaatgaccgcatcaatcaagcgctgtct
gtccataaagacccgtggaaagactttttggaagacggaaagacaacaagacagctattc
gaaaatgttgtcacttcctaa

DBGET integrated database retrieval system