KEGG   Bacillus licheniformis ATCC 14580: BL01845Help
Entry
BL01845           CDS       T00197                                 

Gene name
yclF
Definition
(GenBank) putative oligo-peptide transporter
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
KEGG Orthology (KO) [BR:bli00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BL01845 (yclF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-ProteinID: AAU22049
UniProt: Q65NF9
LinkDB All DBs
Position
complement(449582..451072)
Genome map
AA seq 496 aa AA seqDB search
MSNHQKETFQNIPQKGFFGHPRGLFTLFFTEFWERFSYYGMRAILIYYLYTEVTKGGLGF
DQTTANSIMAVYGSLVYMSGIIGGWIADRLLGTANTVFYGGVLIMFGHILLSFPGSVPAF
FISMFLIIIGTGLLKPNVSSVVGDLYSPEDTRRDSGFSIFYMGINLGGFLAPIIVGTVGQ
TYNYHLGFSLAAIGMLFGLLTYLATRKKNLGSAGRTVPNPLTPAERKMVFGRIGIGVLVI
AAIFGYSIFMGWMTIKLFTMIVSCLGILIPLIYFIVMFKSSKTTSDERSRLTAYIPLFVA
SMMFWAIQEQGANILATYADKRTHLEFLGVQLHSSWFQSLNPLFIVVLAPVFAWIWMRLG
NRQPSTPTKFSLGLILAGLSFVVMIFPAYINGTESLANPMWLVLSFLIVVLGELCLSPVG
LSATSKLAPAAFSAQTMSLWFLSNASAQAINAQIVRFYSVDTEIAYFGIIGGVSILLGII
LMLLSPKIQKFMKGVN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccatcaaaaagaaacttttcaaaacattccgcaaaaggggttttttggacat
ccccgcggactcttcaccttattcttcactgaattttgggagcgcttttcatactacggc
atgagagccatccttatctattatttgtatacagaggtgacaaaaggcggcctcgggttt
gatcaaacgacagcgaactcgattatggccgtatatggttccctcgtctatatgtccggc
attatcgggggctggatagcggacaggctcctcggaactgcaaacaccgtgttttacggc
ggcgtgctcattatgttcggacacattcttttgtcattcccgggaagcgtccccgctttc
ttcatcagcatgttcttgatcatcattgggacaggccttttaaaacctaacgtatcaagc
gttgtcggcgatttgtacagccctgaagacacccgccgcgattctggtttcagcatcttc
tatatgggaatcaaccttggcggatttctcgcgccgattatcgtcggcacagtcggtcag
acatacaactaccatctcggcttcagccttgctgccatcggcatgttgttcggactgctg
acctatttagcgacgcggaagaaaaacctcggatctgccggaagaacggtaccgaatccg
ctcacaccagctgaaaggaaaatggtgttcggacggatcgggatcggtgttttggtgatc
gctgccatctttggctattccatctttatgggctggatgacaatcaagctgtttacgatg
atcgtcagctgtctcggcattttgatcccgctgatttatttcatcgtcatgtttaaaagc
tccaagacgacgagtgatgaacgttcccgtctcacagcttacattccgctgtttgtcgca
tcgatgatgttttgggcgattcaggaacaaggcgccaatattttagccacctatgcagat
aaacgcactcatttggaatttttaggtgtccaattgcactcttcttggttccagtcgctg
aatccgttgttcatcgttgtgcttgcaccggttttcgcatggatttggatgaggctcgga
aaccgtcagccgtcaacgccgacgaagttttcactcgggttgattttagccggactgtca
tttgtcgtcatgattttccctgcttacatcaacggcactgaatcgcttgccaatccaatg
tggcttgtgctcagcttcctgatcgtcgttctcggggaattgtgcttgtctccagtcggg
ttatccgcaacgtcaaagctggctcctgctgctttctcagcgcagacgatgagtctatgg
ttcctgtcaaacgcttctgcacaggccatcaacgcacagatcgtcagattttacagcgtt
gataccgagatcgcctacttcggcatcatcggcggtgtatccatcctgctcgggatcatt
ttgatgctgctgtcaccgaaaattcagaaatttatgaagggtgttaattaa

DBGET integrated database retrieval system