KEGG   Bacillus licheniformis ATCC 14580: BL02150Help
Entry
BL02150           CDS       T00197                                 

Gene name
yunF
Definition
(GenBank) conserved protein YunF
Organism
bli  Bacillus licheniformis ATCC 14580
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF72
Motif
Other DBs
NCBI-ProteinID: AAU24889
UniProt: Q65FA6
LinkDB All DBs
Position
complement(3274384..3275235)
Genome map
AA seq 283 aa AA seqDB search
MIYIGLTGWGDHDSLYPPKTSSQNKLIHYSSHFPIVELDASFYAIQPERNNEKWVKETPE
TFQFIVKAYQGMTGHQRGEIPFETKDDMFAAFKLSLTPYIKAGKLAMVLFQFPPWFDCKK
ENVNYLRWVKEKMGDIPCALEFRHRSWFMPQFYDKTLAFMEEQQWIHSICDEPQAGEGSI
PTVLHATDSRKTLVRFHGRNKEGWLRPSSGQNWREVRYLYLYNEQELKDWKRNLELLEQQ
SKNVYVLFNNNSGGDAAQNGKQMMELLNIEYKGLTPRQLDLFS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgatttatattggattaacaggatggggggatcatgacagcctgtatccgcccaagaca
agcagtcaaaacaagctgatccactattcatcgcattttccgatcgtcgagcttgatgcg
agcttttacgcgatacagcccgagcggaacaatgaaaagtgggtaaaggagacgccggaa
acctttcagtttatcgttaaggcatatcagggaatgacagggcatcagcgcggggaaatc
ccctttgaaacgaaagacgacatgtttgctgcttttaagctctcattaacgccatacata
aaagcgggtaagctggcgatggtcctctttcagtttccgccatggtttgattgcaagaaa
gaaaacgtcaattacttaagatgggtaaaagagaaaatgggagatatcccgtgtgcgctt
gaattcaggcataggtcatggtttatgccccagttttacgacaaaacgctcgcttttatg
gaggagcagcaatggattcacagcatttgcgatgaaccccaggcgggcgaaggcagcatc
ccgactgttcttcacgcgactgacagccggaaaacgctcgtccgttttcacggccgcaac
aaggaaggctggttaaggccatcttccggtcaaaattggcgtgaggtcagatatttgtat
ttatataatgaacaagaattaaaagactggaaaagaaaccttgagctgcttgaacagcag
tcgaaaaacgtttacgtgctgtttaataacaattcgggcggtgatgcggctcaaaacggt
aagcaaatgatggagctgctcaacattgaatacaaagggcttacgccaaggcagctcgat
ttattcagctag

DBGET integrated database retrieval system