KEGG   Bacillus licheniformis ATCC 14580: BL02302Help
Entry
BL02302           CDS       T00197                                 

Gene name
prkC
Definition
(GenBank) protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Brite
KEGG Orthology (KO) [BR:bli00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bli01001]
    BL02302 (prkC)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BL02302 (prkC)
Protein kinases [BR:bli01001]
 Serine/threonine kinases: Other
  Bacterial family
   BL02302 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo RIO1 Seadorna_VP7 Haspin_kinase Pkinase_fungal DLEU7
Motif
Other DBs
NCBI-ProteinID: AAU23333
UniProt: Q65JS1
LinkDB All DBs
Position
1756945..1758918
Genome map
AA seq 657 aa AA seqDB search
MLIGRRISGRYEILRAIGGGGMANVYLALDIILDREVAIKVLRFDFVHDADFIRRFRREA
QSAASLDHPNIVSIYDVGEEDDIYYIVMEYVEGMTLKEYINRTGPLHPKEAVQIMEQIVS
AIAHAHDNQIVHRDIKPHNILIDHMGHIKVTDFGIAMALSSTTITHTNSVLGSVHYLSPE
QARGGLSTKKSDIYSLGIVLFELLTARMPFEGESAVSIALKHLQSETPSVKRWNPAVPQS
IENVVLKAMAKDPFHRYEAAEEMENDLKTAFDPDRLNEKRFTIPSDDEMTKAVPIIKNLP
ENGSSSQSGGGEEEAAPLSKKEKKKQAKANKKKKRKKWPLILLTVFFVLAASAVLALTVF
PSLFIPKDVAVPDVAGLEYEEAVIKLEDEGFEVDPNAEDIADDKIEEGLIVKTDPAAGDI
VKEGSTVKLYKSSGKEKTEVDDVVGQKVDAAKKLLEQKGFKNIKTEEVHDEEEAGTIIEQ
DPAAGTEIVAADDEVKLTVSLGPEAITLRDLKTYSKQAASGYLDDHQLVLVEKEAHSEDV
PEGQVIKQKPEAGASVKPGDKVEVTFSLGPKQKPVKTVTEKIDIPYEPGAAGEEQNVQIS
IDDEEHSISDVYENFKITAPAERTIKFRIAPGQKGYYQVTINDKVVRSKTIEYPEDE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgttaatcggcagacggatcagcggacgttacgaaatcctgcgcgccatcggcggcggg
gggatggcgaacgtttatttagcgctggacatcatcctcgaccgtgaagtcgcgattaaa
gtgctgcggtttgacttcgttcacgatgccgattttatcaggcggttcagacgggaagcg
cagtccgctgcaagcctcgaccacccgaatatcgtcagcatttatgatgtcggagaagaa
gatgacatctattatatcgtgatggagtatgtcgaggggatgaccctgaaagaatacata
aatcgaacaggcccacttcatccgaaagaagcggtccaaatcatggagcagatcgtatcc
gccatcgcacatgcccatgataaccagattgtccaccgggatattaagccccacaacatt
ttgatcgaccatatgggccacattaaagtgactgatttcggcatcgccatggcgctcagc
tcgacgaccatcacgcacaccaactcggttttgggctctgtccattatttgtcgcccgaa
caggcgagaggcggattatcgacgaaaaaatccgatatctactcgctcggcatcgtgctt
ttcgagctgctgacggcgcgtatgccgtttgaaggagaatcggcggtcagcatcgcgctg
aaacatctccaatcagaaacgccgtcggtgaaaagatggaacccggccgtgccgcaaagc
atagaaaacgtcgtcctgaaagcgatggcaaaagatccattccatcgctatgaagcggcc
gaagagatggaaaacgatttgaaaacggctttcgacccggaccggctcaacgaaaagcgc
ttcacgattccatccgatgatgagatgacgaaagcagttccgatcatcaagaatctgccg
gaaaacgggagcagctcgcaatccggcggcggagaagaggaagcggctccattatcaaaa
aaagaaaagaagaagcaggcaaaagcaaacaagaagaaaaaaagaaagaaatggccgctt
atattgctgacggtgtttttcgttctggctgcgtcagccgtcttggctttaacggtgttt
ccgtcgctctttattccgaaagatgtggccgttcccgatgttgccggccttgaatatgaa
gaagccgtcatcaagcttgaagacgaaggatttgaagttgatccgaatgctgaagacatt
gccgacgataaaattgaagaagggctgatcgtgaagacggaccctgcagccggcgatatc
gtgaaggaaggttcaactgtcaagctatataaaagctcaggcaaagagaaaactgaagtc
gatgatgtggtcggccagaaagtcgatgccgccaagaagcttcttgagcaaaaaggcttt
aaaaacatcaagacagaagaagtgcacgatgaagaagaagcgggaaccatcatcgaacag
gaccctgcagccggaaccgaaatcgttgccgccgacgacgaggtcaaattaacggtcagc
ctcggtccggaagccattactttaagggatttaaaaacatacagcaaacaggcggcttcg
ggctatttggacgaccatcagcttgtccttgtcgaaaaggaggcgcattctgaagacgtg
ccggaaggtcaggtcattaaacaaaagccggaggcgggggcatcagtcaagccgggagac
aaagtcgaggtcacgttttcgctcggacctaaacaaaagcccgtcaaaacggtgaccgag
aaaattgatattccttatgaaccgggagcggcgggcgaagaacaaaacgtccaaatttcg
atcgatgatgaagaacacagcatttctgacgtctacgaaaatttcaaaatcacagcgccg
gcagagcggacgatcaaattcaggattgcgcccggccaaaaagggtattatcaagtaacg
atcaacgataaagtagtcaggtcaaaaacgattgaatatcctgaggatgaataa

DBGET integrated database retrieval system