KEGG   Bacillus licheniformis ATCC 14580: BL02622Help
Entry
BL02622           CDS       T00197                                 

Gene name
yukE
Definition
(GenBank) conserved protein YukE
Organism
bli  Bacillus licheniformis ATCC 14580
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 T7SS_ESX_EspC LXG PPE DUF3958 FapA Fzo_mitofusin ApoLp-III PilJ Baculo_PEP_C DUF4085 MDM1 UPF0449 OmpH Latarcin DUF2894 Spt5_N DUF3437 Prominin BLOC1_2 SLATT_6 NitrOD1 YtxH DUF1043 ZYG-11_interact
Motif
Other DBs
NCBI-ProteinID: AAU24841
UniProt: Q65FF4
LinkDB All DBs
Position
complement(3232160..3232456)
Genome map
AA seq 98 aa AA seqDB search
MSGIIRVTPAELRQMADRYQKESGDVTEQVNQRLDQMINQLQDMWEGESSRAFSEQYQEL
RPSFIKMAELLSDVSKQLHQTANTLESTDQDIASQIRG
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaatcattcgtgttacgccggctgaactgcggcaaatggctgacagatatcaa
aaagaaagcggagatgtgactgagcaggtcaatcagcgtcttgatcaaatgatcaaccag
cttcaagatatgtgggaaggtgaatcaagccgtgcgttctcagagcaataccaagagcta
agaccttcttttattaaaatggctgaacttctaagcgacgtttctaaacagcttcatcag
actgctaacactcttgaaagcactgaccaagacatcgctagccaaatccgcggctaa

DBGET integrated database retrieval system