KEGG   Bacillus licheniformis ATCC 14580: BL02902Help
Entry
BL02902           CDS       T00197                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00564  Glycerophospholipid metabolism
bli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BL02902 (glpD)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BL02902 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 FAD_oxidored FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AAU22561
UniProt: Q65M10
LinkDB All DBs
Position
999183..1000850
Genome map
AA seq 555 aa AA seqDB search
MESLFSSRKRDDILQNMTKQKYDVFIIGGGITGAGTALDAASRGMKTALCEMQDFAAGTS
SRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFST
SIGLRVYDFLAGVKKAERRSMLTAEETLQKEPLVKKNGLKGGGYYVEYRTDDARLTIEVM
KEAVKFGAEAVNYAKVSDFIYENGKVTGVVIEDVFTKKTYRVYAKKIVNAAGPWVDRLRE
KDHSKEGKHLQHTKGVHLVFDQSVFPLKQAVYFDTPDGRMVFAIPRDGKAYVGTTDTVYN
ENLEHPRMTTADRDYVINAINYMFPELGIKAEDVESSWAGLRPLIHEEGKDPSEISRKDE
IWTSESGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGDRDFGPCRTKTMPISGGHIGGS
KNLEAFIQAKAAEGIEAGLSEETAKQIAARYGSNADRLFDRIPSLKDEAAKRRIPVHVLA
EMDYGIEEEMAAVPADFFVRRTGALFFDINWVRTYKESLTDYMSEKLNWDGETKARHVKA
LEGLLHDAVVPLESK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggaatcattattttcaagccgtaaacgggacgacattttacagaatatgacaaagcag
aagtatgacgtgtttattatcggcggaggtattactggggcagggacggcattggatgcc
gcatcgcgcggaatgaaaacggcgctttgcgaaatgcaggactttgcagccggaacgtca
agccgttccacgaaacttgtacacggcgggcttcgctatttaaagcaatttgaagtgaaa
atggtagccgaggtcggcaaagagcgggcgatcgtctatgaaaacgggccgcacgttaca
acgcccgaatggatgctgcttccgatgcataagggagggactttcggcaaattcagcact
tcaatcggactgagggtgtacgactttttggcaggcgtcaaaaaagctgagcggaggagc
atgctgactgccgaagaaacgcttcaaaaagagccgctcgtgaaaaagaacggcctgaag
ggcggcggctattatgtcgaataccggacggatgatgccagattgacgatcgaagtcatg
aaagaagccgttaaattcggagccgaggccgtcaattatgcaaaagtaagcgattttata
tatgaaaacggcaaggtcaccggcgtggtcattgaagacgtcttcacgaaaaaaacgtac
cgcgtctacgcgaaaaaaattgtcaatgccgcggggccgtgggtcgaccgtctgcgggaa
aaagaccattcaaaagaaggcaaacaccttcagcatacaaaaggcgtgcatcttgttttt
gatcaatcggtctttcctttaaaacaagccgtttattttgatacgcctgacggccgcatg
gtgttcgccattccgagagacggaaaggcatatgtcggcacaacagacaccgtctacaac
gagaatttggaacaccctcgaatgacgacagcagacagggattatgtcatcaatgcaatc
aactatatgttccctgaacttggaatcaaagccgaagatgtcgaatcaagctgggctggc
ctcagaccgctgattcatgaagaaggaaaagacccgtccgagatttcccgaaaagatgag
atctggacttctgaatccggactgatcacgatcgccggcggaaagctgacaggctacaga
aaaatggctgagcatatcgtcgatcttgtcagagaccgattaaaagaagagggcgacaga
gacttcgggccttgcagaacaaaaacgatgccgatttcaggcggccatatcggcggctcc
aaaaatctggaggcttttattcaagcgaaagcagccgaagggattgaggccggactgtcc
gaagagacggccaaacaaatcgccgcacgatacggttcgaacgcagaccgcctgtttgat
cgtattccatcgctgaaagatgaagcagcaaaacgccgcatccctgtccatgtactagca
gaaatggattacgggatcgaggaagaaatggcagccgtcccggcagacttcttcgtccgc
agaaccggtgcgctgttctttgacatcaattgggtccgcacttacaaagagagccttacg
gactacatgagcgagaagctgaactgggatggcgaaacgaaggcccggcatgtcaaggca
ttggaaggactactacacgatgctgttgtcccgctggaaagcaaatga

DBGET integrated database retrieval system