KEGG   Bacillus licheniformis ATCC 14580: BL03122
Entry
BL03122           CDS       T00197                                 

Gene name
levF
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIC component
  KO
K11196  fructose PTS system EIIC component
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00051  Fructose and mannose metabolism
bli02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BL03122 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BL03122 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bli02000]
    BL03122 (levF)
Transporters [BR:bli02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BL03122 (levF)
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AAU24333
UniProt: Q65GW5
LinkDB
Position
complement(2715792..2716595)
AA seq 267 aa
MSTIQIILLLVIAAITGIGSVLDEGQTHRPLIACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFLIH
RADKYAKDGNFKGIEIMHITAMAFQALRVMIPTLIVALISVSAVQAFLGNIPEVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLAFLYQQVMQ
KNHAQGAVAAASDGSMAAYDDDDDLDA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtcaacgattcaaatcattttgctgcttgtcatcgctgctataacaggtatcggtagt
gtattggacgaagggcagacacatcgcccgctgattgcctgcactttggtcggccttgtc
ctcggggatctgaaaacaggcatcattctcggcggaacgctggagctgatggcgcttggc
tggatgaatgtcggtcttgcaatggcccccgatacggccatcgcttccgtgatttcgact
atcttagtgattaccgccgatcagggaatcggcgaagggatcgccgtcgcggtggctttg
gcagctgcgggtcaggcgctgacgattttcgtccggacgatcaccgtatttttaattcac
cgcgccgacaaatacgcaaaggatggcaattttaaaggaattgaaattatgcatataact
gccatggcgtttcaggcgctgcgcgttatgattccgacattgatcgtggctctgatcagt
gtcagcgctgttcaggcgtttttgggaaatattccggaagtcatcacaaaaggcttgcaa
ataggcggaggcattatcgttgttgtcgggtatgcgatggtcatcaacatgatgaacatt
ccgtatttgaagccgtttttctatatcggttttttgctggccgcgttcaccgatttcaat
ttagtcggcttcggcgccctcgggctctgtctggcatttttatatcagcaagtgatgcaa
aaaaatcatgctcaaggggcggttgctgccgccagtgacggcagcatggccgcttatgat
gatgacgatgatctggatgcttaa

DBGET integrated database retrieval system