KEGG   Bacillus licheniformis ATCC 14580: BL03123
Entry
BL03123           CDS       T00197                                 

Gene name
levE
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIB component
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00051  Fructose and mannose metabolism
bli02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BL03123 (levE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BL03123 (levE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bli02000]
    BL03123 (levE)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BL03123 (levE)
Transporters [BR:bli02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BL03123 (levE)
SSDB
Motif
Pfam: PTSIIB_sorb KR
Other DBs
NCBI-ProteinID: AAU24334
UniProt: Q65GW4
LinkDB
Position
complement(2716613..2717104)
AA seq 163 aa
MKIVLARIDDRFIHGQVLTRWIKIHAADRIIVVSNEVAQDEMRKTLILSVAPSNVKASAV
SISKMAKAFHSPRYEDTTAMLLFENPGDIVSLIEAGVPIEIVNVGGMRFENNRRQITKSV
SVTEKDIKSFEQLHELGVKLELRQLPSDSSEDFMQMLRNATKS
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaaaatcgttttggcaagaattgatgaccgctttattcacggccaagtattaacaaga
tggatcaaaatccacgctgctgatcgcattatcgttgtctccaatgaggtggcacaggac
gaaatgagaaaaacgctgatcctttctgttgcaccttcaaatgtaaaagccagcgccgtt
tcgatttccaaaatggccaaagcgttccacagtccgcggtacgaagatacgacggcaatg
ctgttattcgaaaatccgggcgacattgtttccttaatcgaagcaggcgttccgatcgaa
atagtcaatgtcggcgggatgcgtttcgagaataaccgcaggcaaatcacgaaatcggta
agcgttactgaaaaggacatcaaatcgttcgaacaattgcatgaattgggcgtgaagctg
gaactgaggcagctgccgtcagattcgagcgaagactttatgcagatgttaagaaacgca
acaaaatcctag

DBGET integrated database retrieval system