KEGG   Bacillus licheniformis ATCC 14580: BL03124
Entry
BL03124           CDS       T00197                                 

Gene name
levD
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIA component
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00051  Fructose and mannose metabolism
bli02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BL03124 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BL03124 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bli02000]
    BL03124 (levD)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BL03124 (levD)
Transporters [BR:bli02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BL03124 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AAU24335
UniProt: Q65GW3
LinkDB
Position
complement(2717104..2717541)
AA seq 145 aa
MITVIISGHGNFPIALKESSGMIFGEEESLIAVPFLKGEGIQTLQEKYHQTLKDVPEEHE
VLFLVDIFGGTPYNAATPYIAKERRFDMAAGVNLPILLEALSLREHMPLKQLLNQLKKMS
RECFQICSEQLEKFSQSNQGREDEL
NT seq 438 nt   +upstreamnt  +downstreamnt
atgattacagtcattatcagcggccacggaaactttcccatagcattaaaagaatcttca
gggatgatattcggagaagaggagagcctgatcgcggtgccgtttctgaaaggggaaggc
attcagacactgcaagaaaaatatcatcagacgctgaaggatgttccggaggaacacgag
gtgctttttttagtggatattttcggcgggacgccatataacgcagcgaccccttacatc
gcgaaagagcggagattcgatatggcagccggagtgaacctgccgattttgttagaggca
ttgagcttgagggagcatatgccgctcaaacaactgctgaaccagttgaaaaagatgagc
cgggaatgcttccaaatatgcagcgagcaattggaaaaattcagtcagtccaatcaggga
agagaggatgaattgtaa

DBGET integrated database retrieval system