KEGG   Bacillus licheniformis ATCC 14580: BL03413Help
Entry
BL03413           CDS       T00197                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase and phosphoribosyl-ATP pyrophosphohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00340  Histidine metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01230  Biosynthesis of amino acids
Module
bli_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BL03413 (hisI)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BL03413 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BL03413 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AAU25179
UniProt: Q65EG4
LinkDB All DBs
Position
complement(3556149..3556781)
Genome map
AA seq 210 aa AA seqDB search
MIKADELTFNEAGLIPAIVQDAASKEVLTLAYMNKESFEKTLETKETWFFSRSRGELWHK
GATSGNIQRVKDIRLDCDQDALIVLVEPAGPACHKGSYSCFSPGEHIRQTDGGRFDIINE
LETVIAKRQAEMPEGAYTTYLFREGVDKILKKVGEEAAEVIIAAKNRDPEELKWEAADLL
YHLLVLLREQSLPLDDVLGVLKERHEGSES
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggcagacgagttgacatttaatgaagccggcttgatcccggcgattgtccag
gatgcagcgagcaaagaagtgctgacacttgcttatatgaataaagaatcgtttgaaaaa
acgctggaaacgaaggagacatggtttttcagcagatcgcgcggagagctctggcataag
ggagcgacgtcgggtaacattcagcgtgtgaaagacatcaggcttgactgtgatcaagat
gcgctcatcgtgcttgttgaaccggcggggccggcctgtcataaaggaagctacagctgt
ttctcgcccggcgaacatatcagacagactgatggcggccgctttgacatcatcaatgaa
cttgaaaccgtcattgccaaacggcaggctgaaatgcctgaaggcgcatatacaacatat
ttgttccgtgaaggcgttgataagattttgaagaaagttggcgaagaagcggcggaagtc
atcatcgctgcaaaaaaccgtgatcctgaagaactgaaatgggaggcggctgaccttctt
taccatctgctcgttttgctgagggagcagtcccttccgcttgatgatgtgcttggcgtc
ttgaaagagcgccatgaaggatctgaatcataa

DBGET integrated database retrieval system