KEGG   Bacillus licheniformis ATCC 14580: BL03539Help
Entry
BL03539           CDS       T00197                                 

Gene name
mtnV
Definition
(GenBank) Aminotransferase, class I and II
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00270  Cysteine and methionine metabolism
bli01100  Metabolic pathways
Module
bli_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BL03539 (mtnV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bli01007]
    BL03539 (mtnV)
Enzymes [BR:bli01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BL03539 (mtnV)
Amino acid related enzymes [BR:bli01007]
 Aminotransferase (transaminase)
  Class I
   BL03539 (mtnV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AAU23061
UniProt: Q65KJ9
LinkDB All DBs
Position
1488614..1489804
Genome map
AA seq 396 aa AA seqDB search
MKFEHSDVLKQLPEQFFASLVKKVNEKIAAGHDVINLGQGNPDQPTPEHIVDTMAQAVRN
PENHRYSSFRGSRSLKEAAAAFYQREYGVELDPEREVAVLFGGKAGLVELPQCLLNPGDT
VLVPDPGYPDYWSGVELARANMETMPLTADNQFLPDYSRIPKEVKEKAKLMYLNYPNNPT
GAQATSAFFEETVRFAKSNGICVVHDFAYGAIGYDGKRPVSFLETAGAKDAGIEIYTLSK
TYNMAGWRVGFAVGNASVIEALNLYQDHMYVSLFKAVQDAAAAALLSDQACVQEQNERYE
KRRNAWIRAVRDIGWHADAPQGSFFAWMPVPDGYTSEAFSDLLLEKANVVTAPGIGFGKH
GEGYVRVGLLTSEERLREAASRIAELNIFKKTGHSH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgagcattcagatgtactgaagcagctgccggagcagtttttcgcttccttg
gtcaaaaaggtgaatgaaaaaattgccgccggccatgatgtcatcaatctcggtcagggg
aatccggatcagccgacaccggaacatatcgttgatacaatggcgcaagccgtccgcaac
cctgaaaaccaccggtattcttcctttcgcggcagccgttcactcaaggaggcggcggcc
gcgttctatcaaagggaatacggcgtagagctcgatcctgaacgcgaagtcgctgtattg
ttcggcggaaaagccggtcttgtcgaacttccgcaatgtttgttaaatccgggggataca
gtgctcgttcccgatcccggctatcccgactactggtcgggcgttgaactggcaagagcg
aacatggaaacgatgccgcttacagcggacaatcagtttctgcctgactacagccggatt
cccaaggaagtgaaagaaaaagcgaagctcatgtatttaaattatccgaacaacccgacc
ggtgcccaagccacatctgcttttttcgaagagaccgtccggtttgccaagtcgaacgga
atttgcgtcgtccatgattttgcctacggcgcgatcggctacgacggcaagaggcctgtc
agctttctcgaaacggcgggagcaaaagacgcaggaatcgaaatttacacgctttccaaa
acgtataatatggctggatggcgggtcgggtttgcagtcggcaacgcctctgtgatcgaa
gcgctgaacctttaccaggaccatatgtatgtcagcctctttaaagcagtccaagacgcc
gcggcggccgcgctcctatcagatcaagcgtgtgtccaggagcaaaatgagcgctacgaa
aaaaggcggaatgcatggatccgcgcggtccgcgatatcggctggcatgcggatgctccg
caaggatcttttttcgcctggatgcctgttcccgacggctatacatctgaggctttttcc
gatctgcttctcgaaaaagcgaatgtcgtcaccgcgcccggcatcggcttcggcaaacac
ggggaaggctatgtgagagtcggcctcttgacaagcgaagagcggctccgggaagcggct
tcgcgtattgccgagctgaatatattcaaaaagaccggccacagtcattga

DBGET integrated database retrieval system