KEGG   Bacillus licheniformis ATCC 14580: BL05046
Entry
BL05046           CDS       T00197                                 

Gene name
yrhM
Definition
(GenBank) YrhM
Organism
bli  Bacillus licheniformis ATCC 14580
SSDB
Motif
Pfam: DUF3298 PdaC DUF4179 CENP-W DUF835 Dicistro_VP4
Other DBs
NCBI-ProteinID: AAU22190
UniProt: Q65N19
LinkDB
Position
593403..594263
AA seq 286 aa
MDKKLEQLRKAYQNVPIPKELDQVVETALQHKPKKKRRIVVWPASTLVAAAVLLAAVVNI
NPGAAQAMSQIPVIGKVVKAITFTEIKQKDGESSIDVKTPALSGLNNRELENGINEKYVK
ESHQLYREFMKETSRNKKGHLSIYSDYETVTDTKDLISIRRSVERTEASSYTERRYITID
KKNEVLLTLKSLFKDDRYITAISENIKEQMKQQMKDDPDKIYWIGDEEVEPFKRIKADQN
FYITENHKLVISFDDYEVAPGYMGAVEFEIPTKAISNLLIGDRYIR
NT seq 861 nt   +upstreamnt  +downstreamnt
atggataagaaattggaacagctgagaaaagcatatcaaaacgtccccattccgaaggag
ctggatcaggttgtcgagactgcgcttcagcataaaccgaagaagaagagaaggatagtg
gtatggcccgcatcaacgctggtcgcggcggctgtactattggctgccgtcgtgaatatc
aatcccggagcagcgcaggccatgtcgcagatacctgtcatcggcaaggtcgttaaagcc
atcacattcaccgagatcaaacagaaagatggagaatcgagcattgacgtgaaaacaccg
gctctttccggcttgaataaccgggagctcgaaaatggcatcaacgagaaatatgtaaag
gaaagccatcagctttaccgggaattcatgaaggagacgtcccggaataaaaaagggcat
ctcagcatctacagcgattatgagacagtcacggatacgaaagatttgatttcgattcgg
cgaagcgtcgaaagaacggaagcgtccagctataccgaacggcgctatatcaccattgac
aaaaagaatgaagtcctgctcaccttgaaaagcttgtttaaagacgaccggtatatcacc
gccatcagcgaaaacattaaagagcaaatgaaacagcaaatgaaagatgatcctgataaa
atatattggatcggtgacgaagaagtcgagccattcaaacgaatcaaggccgaccaaaat
ttttacattacagagaatcataaactggtgatttcgtttgatgattatgaagtcgctccc
ggctatatgggcgcggtggagtttgaaattccgactaaggcgatttcgaacctgctgatc
ggcgaccgctatatccgctag

DBGET integrated database retrieval system