KEGG   Brevibacterium aurantiacum: BLSMQ_1038Help
Entry
BLSMQ_1038        CDS       T04775                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
blin  Brevibacterium aurantiacum
Pathway
blin00564  Glycerophospholipid metabolism
blin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLSMQ_1038
Enzymes [BR:blin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BLSMQ_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored PilX_N Pyr_redox_2 3HCDH_N NAD_binding_8 HTH_28 AlaDh_PNT_C Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AOP52750
UniProt: A0A1D7W187
LinkDB All DBs
Position
1134927..1136648
Genome map
AA seq 573 aa AA seqDB search
MRNGELSPSFRDEALHTLENTSPDDPLDVFVVGGGVTGAGSAFDAATRGLKVGVVDAKDW
ASGTSSRSSKLMHGGLRYLEMLDFKLVAEALKERDLLLQHTAPHLVEPVAFVFPFEHRLI
DRAFIGSGVLLYDTMATRPGRKRAVPMHRHLGKKALTAHFPGLADDAAVGALEYYDAKVD
DARFVMTLIRSAVGYGAAAANHVSVIDYLHDGDRVSGVRARDEMTGREFDIHARRTILAG
GVWTEEQQDLAKADAGLQVLASKGVHITVEQDKIKADPNTGIISKTEKSVLFVIPWEGYW
VIGTTDTPWDQDVDAPVANSDDIDYLLKHANAILTEKLSRNDVIGVYSGLRPLLQPVVKE
GQASTKVSREHTVMEIEPALAAIAGGKFTTYRVMAEDAVDFVLGDDAKDRRSLTESIPLL
GAQGVGAVRRGQSGIAEKHGWDEDRVRRLIRRYGTLLEDILDLIDEDPELGRPLPGAESY
LRAEAHYAATSEGAVHLGDILERRMRLNYEVRDRGKYAAEAVAAIVAPILGWDDEREAKE
IADFNAHVDAQIAAESTHDDAAAAALVEETLKP
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaatggcgagctgtccccatcgttccgcgatgaagccctgcacaccctggagaac
accagcccggacgatccgctcgacgtcttcgtcgtcggcggaggcgtcaccggagcaggt
tccgccttcgatgcggccacccgcgggctgaaggtcggtgtcgtcgatgccaaggactgg
gcttccggcacctcgtcacggtcctcgaagctcatgcacggcggactgcgctacctggag
atgctcgacttcaagcttgtggccgaggcgctgaaggaacgcgacctgctgctccagcac
acagcgccccacctcgtcgaacctgttgccttcgtcttccccttcgaacaccggctcatc
gacagggcattcatcggttccggcgttctgctctatgacacgatggccacccgtcccgga
cgcaaacgtgccgtgccgatgcaccgccacctgggaaagaaggcactcaccgcccatttc
cccggcctggccgacgatgcagcggtcggtgcactcgaatactatgatgcgaaggtcgac
gacgcccgtttcgtcatgacgctcatccgctctgctgtgggctacggcgccgccgcggcc
aatcacgtctccgtcatcgactacctccacgacggggaccgggtctccggagtccgtgcc
cgtgatgagatgaccggccgagaattcgacatccacgcccgccgcaccatccttgccggg
ggagtctggaccgaggagcagcaggacctggccaaggccgacgccggcctccaggtgctc
gcctccaaaggtgtgcacatcacggtcgagcaggacaagatcaaggcagacccgaacacg
ggcatcatctcgaagacggagaagtccgtgctcttcgtgatcccgtgggagggctactgg
gtcatcggcaccacggacaccccgtgggaccaggatgtcgacgcaccggtggcgaactct
gatgacatcgactacctgctcaagcatgcgaacgcgatcctgaccgagaagctgagccgc
aacgacgtcatcggcgtctactccggtctccgacctctgctccagcccgtggtcaaggaa
ggtcaggcctcgacgaaggtctcccgtgaacacacggtgatggagatcgagcccgctctg
gcagcgattgccggcggcaagttcaccacgtatcgcgtcatggcagaagacgccgtcgat
ttcgtcctcggcgatgacgcgaaggaccgccgctccctgaccgaatcgatcccgctgctg
ggtgctcagggcgtcggcgccgtgcgccgcggccagtccggcatcgccgagaagcacggg
tgggacgaagaccgggtcaggcgactcatccgccgctacggcaccctgctcgaagacatc
ctcgaccttatcgacgaggatcccgaactcggtcgcccgctgcccggtgccgaaagctat
ctgcgcgccgaggcacactatgcggcgacctcggaaggtgccgtccacctcggcgacatc
ctcgaacgacggatgcggctgaactatgaggtcagggaccgaggcaagtacgccgccgag
gcggttgcggcgatcgtcgccccgatcctcgggtgggacgacgaacgggaagcgaaggag
atcgctgacttcaacgctcacgtcgacgcacagatcgccgctgaatccacccacgacgat
gccgcggctgcggcactcgtcgaggaaacactcaaaccgtaa

DBGET integrated database retrieval system