KEGG   Brevibacterium linens SMQ-1335: BLSMQ_1370Help
Entry
BLSMQ_1370        CDS       T04775                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
blin  Brevibacterium linens SMQ-1335
Pathway
blin03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:blin00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BLSMQ_1370
Enzymes [BR:blin01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BLSMQ_1370
DNA repair and recombination proteins [BR:blin03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BLSMQ_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AOP53080
UniProt: A0A1D7W274
LinkDB All DBs
Position
1477552..1478451
Genome map
AA seq 299 aa AA seqDB search
MSSSAEVAGVPIDKADKEMFGPDDGGPITKVDLAKYYSDVAEVMLPHTRDRPISMQRFPD
GIAAESFYEKKYPDHFPDFVEAVRVATQDGDQDQVMINNAQSLVYLADQASITPHTWLAT
SADLDHPDQLIVDLDPSVPGIDAVRKATVMVGELMEELGLRAFVKTTGSRGYHVQVPLIV
DHDFDEVRDFARNCARALVDRDPELLTIEARKNKRGNRVLIDIARNAYAQTAVPPYAVRS
RPGAPVAAPITWDELSSTDPRDYTMTSVRNRLAQRDDPWAGIARHRQGIDQAMETLAKL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtcagcggaagtcgcaggagttccgatcgacaaggccgacaaagagatgttc
ggccctgacgacggagggccgatcaccaaggtggacctggcgaagtactactcggacgtc
gccgaggtgatgctgccccacacccgagaccgccccatttcgatgcagcggtttcccgac
ggaatcgccgcggagtcgttctatgagaagaagtaccccgatcatttccccgacttcgtc
gaagcagtgagggtcgcaacgcaggacggtgaccaggaccaggtgatgatcaacaatgcc
cagagtctggtctacctcgccgaccaggccagcatcacaccgcatacctggttggccacc
tcggcggatctcgaccatccggatcagctcatcgtcgatctcgatccctctgttccggga
atcgacgcggtgcgaaaggcgacggtgatggtgggcgagctgatggaggagctgggcctg
agggcattcgtcaagaccaccggctcccgcggatatcatgtgcaggttccgctgatcgtc
gatcacgacttcgacgaggtgcgcgacttcgcgcggaactgcgcaagggcgctcgtcgat
cgggatccggagctgctgacgatcgaggcgaggaagaacaagcgcgggaaccgggtgctt
atcgacatcgcacgcaatgcctacgcccagacggccgtaccgccctatgctgtgaggtcg
cgtcccggagctccggtcgccgcaccgatcacctgggacgaactgtcgtcgacagatccc
cgggactacacgatgacctcggtgcgcaatcgactggcccaacgcgacgatccgtgggcc
ggcatcgcccgccaccgacagggcatcgatcaggcgatggagacgctggccaagctctga

DBGET integrated database retrieval system