KEGG   Brevibacterium aurantiacum: BLSMQ_2361Help
Entry
BLSMQ_2361        CDS       T04775                                 

Definition
(GenBank) putative serine/threonine-protein kinase pknL
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
blin  Brevibacterium aurantiacum
Brite
KEGG Orthology (KO) [BR:blin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:blin01001]
    BLSMQ_2361
Enzymes [BR:blin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BLSMQ_2361
Protein kinases [BR:blin01001]
 Serine/threonine kinases: Other
  Bacterial family
   BLSMQ_2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Pkinase_fungal Haspin_kinase Kdo
Motif
Other DBs
NCBI-ProteinID: AOP54067
UniProt: A0A1D7W4T1
LinkDB All DBs
Position
2568885..2571026
Genome map
AA seq 713 aa AA seqDB search
MSARTDPLIGTVLNDRYRIDAKIARGGMAMVYRGTDLRLDREIAIKVMHEHLISDETFVE
RFRREAINAGRLTHPNLVAIHDQSRDGDTVYLVMEHLPSVTLRRELKHRGTFTPRQAIVV
LDAILAALEAVHSTGIIHRDLKPDNVLLGTDGQVKLADFGLARAVTTATTTKTLIGTVGY
VAPELVTRAGADIRTDLYTVGIMFYEMLTGKQPYTDEVPIQVAYRHVHDSVPPPSDQITG
LSPRLDALVLWATSKDPNDRPDDAAEFRLALAEARSEMSDAELDFGDPNVLPGEHSPALT
ASIDLGAEAPKEKRSRTDEIPYLDNDEEESETAAAADSDDSSDQDTGGGAGTAAAAGVAG
AGAAAIGAAGAAAAATADDSGEPSDDASQDDTDHSDDESRDGKPDSVDKHAGAASAASAA
AAGGAGGAGATGESGTEAAGASAAASAAPHRRRRRRLATTIGAALLVLALVAWLVIANLP
APTSIVPAQLAGKDIDKVSSQIENSGLEAQPKEVFDDTVPAGTVIGTDPVGGSELAPDST
VTVVVSKGEEMFAVPKLKGLSKDKAEDALNKADLKLGKVDEEYSDSVDKDTVISASKKSG
DELSKDTKVDLVVSKGVKPTPVPNVEGLTFDAAYATLAKRGFRVGKDEVFSDDIPKGKVV
SQWPKSSEAKPYDSLIIVRVSKGKEKKEESKDDKKDEKKKDEDKKKDSDKKDD
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcccgcacggatccgctcatcggcaccgtactcaatgaccggtatcgcatcgat
gcgaagatcgcgcgcggtggaatggccatggtctaccgcggcaccgacctgcgactcgac
cgtgagatcgcgatcaaggtcatgcatgagcacctcatcagcgacgagaccttcgtcgag
cggttccgccgcgaggccatcaacgccgggcggctgactcatccgaacctcgtcgccatc
catgaccaatcgcgtgacggcgacaccgtctatctcgtgatggagcacctgccctcggtg
accctgcgccgtgagctcaagcaccgcggcacgttcactccgcgacaggcgatcgtggtt
ctcgatgcgatcctggctgcgctcgaagcagtccattccaccgggatcattcaccgagac
ctcaaacccgacaatgtcctcctgggcacagacggtcaggtcaagctcgcagacttcggg
ctcgcacgcgccgtgaccaccgcaacgacaacgaagacactcatcggcaccgtcggatat
gtcgcacccgagctcgtcacacgtgccggtgccgatatccgcaccgacctctacaccgtc
ggcatcatgttctacgagatgctgaccggcaaacagccctacacggatgaggtcccgatc
caggtcgcctaccgtcacgtccacgattccgtgcctcccccatcggatcagatcacgggc
ctgagtccccggctcgatgccttggtgctgtgggcgacgtcgaaggatcccaacgaccgc
cccgacgatgcggcagagttcaggcttgctctcgccgaggcgcgatctgagatgagtgac
gccgagctcgatttcggtgacccgaatgtgctccccggcgagcactcccccgcgctgacg
gcgagcatcgatctcggagccgaagctccgaaggagaagcgatcgcgcacggacgagatc
ccctacctcgacaatgacgaagaggaaagcgagaccgccgcggcggctgactcggatgac
tcctcggaccaggacacaggtggtggcgcgggcactgcagcagcggccggtgttgcgggt
gccggtgcagctgccatcggagcggcaggagctgctgctgctgcgacggcagacgactcc
ggagagccttccgacgacgcatcgcaggacgacacggatcactccgacgacgaatctcgt
gacggcaagcccgactccgtcgacaagcacgcgggcgcggcctccgcagccagcgcagcc
gctgctggaggcgccggcggggctggggcgaccggcgagagcggcaccgaagctgcgggt
gcgagtgcagcggcctctgcggcgccgcatcgcaggcgcagacgacgactggcaacgacc
atcggcgctgccctgctcgtcctcgcactcgtggcctggctggtcattgccaatctcccc
gcaccgacctccatcgtccctgcccagctggcaggcaaggacatcgacaaggtgtcctcg
cagattgagaacagcggcctcgaggctcagccgaaggaggtcttcgacgacactgtgccg
gccggaaccgtcatcggcaccgacccggtgggaggatccgagctggcaccagattcgacc
gtcactgtcgtcgtgtccaagggcgaagagatgtttgcagtgcccaagctcaaaggcctc
agcaaagataaggccgaggacgctctgaataaagccgatctgaaactcggcaaggttgat
gaggagtacagcgactcggtcgacaaggacactgtcatctcagcgtcgaagaagtcaggt
gacgaactgtccaaggacacgaaggtcgacctcgtcgtctccaagggcgtcaaaccgact
cccgtgcccaatgtcgagggactgaccttcgacgccgcctatgccaccttggccaaacgc
ggattccgtgtgggcaaggacgaagtcttctccgacgacattcccaagggcaaagtggtc
tcccaatggccgaagagctccgaagccaagccctatgactccctcatcatcgtccgcgtt
tccaagggcaaagagaagaaggaagagtccaaggacgacaagaaggatgagaagaagaag
gacgaagacaagaagaaagactctgacaagaaggacgactga

DBGET integrated database retrieval system