KEGG   Brevibacterium linens SMQ-1335: BLSMQ_3747Help
Entry
BLSMQ_3747        CDS       T04775                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blin  Brevibacterium linens SMQ-1335
Pathway
blin00220  Arginine biosynthesis
blin00250  Alanine, aspartate and glutamate metabolism
blin00290  Valine, leucine and isoleucine biosynthesis
blin01100  Metabolic pathways
blin01110  Biosynthesis of secondary metabolites
blin01130  Biosynthesis of antibiotics
blin01210  2-Oxocarboxylic acid metabolism
blin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blin00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLSMQ_3747
   00290 Valine, leucine and isoleucine biosynthesis
    BLSMQ_3747
   00220 Arginine biosynthesis
    BLSMQ_3747
Enzymes [BR:blin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BLSMQ_3747
    2.6.1.66  valine---pyruvate transaminase
     BLSMQ_3747
Amino acid related enzymes [BR:blin01007]
 Aminotransferase (transaminase)
  Class I
   BLSMQ_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AOP55445
UniProt: A0A1D7W904
LinkDB All DBs
Position
4078777..4080045
Genome map
AA seq 422 aa AA seqDB search
MYRQSSKLANVLYDIRGPVLEEAEAMEAKGHTILKLNIGNPAPFGFEAPEAIVHDMVKQL
PVAQGYSDSRGILSGRRAVVQYYETRGIHNLDTLEVFLGNGVSELITLSLQALCNPGDEI
LVPSPDYPLWTASVALAGGTPKHYLCDEATAWQPDLEDLESKITENTRGIVVINPNNPTG
AVYSRETLKKIVDIARRHDLIIFADEIYEKITYDDVEMVNMATLTGDDVLCLTYSGLSKA
YRIAGYRAGWLAITGPLSEAKSYLEGIKLLANMRMCANVPAQHAIQAALGGKQSIEDLVL
PQGRLGAQMNLAHEGLNSIDGVSAHRASGALYMFAKLDVDKFNITDDEQFALDLLREQKI
LVSHGTAFNWSSPDHFRLVTLPSVEVLDESINRLGEFLSGYQQNAPSTCELPTVKEMSPA
AG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggcagtcgtcgaaattggccaatgtcctctatgacattcggggacccgtcctc
gaagaggccgaggcgatggaggccaagggccacaccatcctcaagctcaacatcggcaac
cctgcacctttcggattcgaagcccccgaggcgatcgtccacgacatggtcaaacagctg
cccgtggctcaggggtactcggattcccgtggaatcctctccggtcgccgcgccgtcgtc
cagtactacgagaccagaggcatccacaatctggacaccctcgaggtgttcctgggcaac
ggagtcagcgaactcatcaccctgtccctgcaggccctgtgcaatcccggcgacgagatc
ctcgtccccagccccgactatcccctgtggacggcatcggtcgccctggccggcggcacc
cccaagcactacctgtgcgacgaagccaccgcctggcagcccgacctcgaggatctcgaa
tcgaagatcaccgagaacacccgcggcatcgtcgtcatcaatccgaacaacccgacgggt
gcggtctactcacgcgagactctgaagaagatcgtcgacatcgcacgccgccacgacctc
atcatcttcgccgacgagatctacgagaagatcacctacgacgacgtcgagatggtcaat
atggctaccctgaccggtgacgatgtcctgtgcctgacctactcgggactgtcgaaggcc
taccggatcgccggctaccgcgccggctggctggccatcaccggaccgctgtccgaggcc
aagagctacctcgagggcatcaaactcctggccaatatgcgcatgtgcgccaacgttccc
gcccagcacgcaatccaggcggcactcggcggcaagcagtcgatcgaggacctggtcctt
ccgcagggtcgcctcggtgcgcagatgaacctcgcgcatgaggggctgaactccatcgac
ggtgtctccgcgcaccgagccagcggtgccctctacatgttcgcgaagctcgatgtcgac
aaattcaacatcaccgatgacgaacagttcgccctcgacctgctgcgcgaacagaagatc
ctcgtctcccacggcaccgccttcaactggtcgagccccgaccacttccggctcgtcacc
ctgccctccgtcgaggtcctggacgaatcgatcaaccgcctcggcgagttcctctccggg
tatcagcagaacgcacccagcacctgcgagctgccgaccgtcaaggagatgtcgccagct
gcggggtaa

DBGET integrated database retrieval system