KEGG   Brevibacterium aurantiacum: BLSMQ_3747Help
Entry
BLSMQ_3747        CDS       T04775                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
blin  Brevibacterium aurantiacum
Pathway
blin00220  Arginine biosynthesis
blin00250  Alanine, aspartate and glutamate metabolism
blin00290  Valine, leucine and isoleucine biosynthesis
blin01100  Metabolic pathways
blin01110  Biosynthesis of secondary metabolites
blin01130  Biosynthesis of antibiotics
blin01210  2-Oxocarboxylic acid metabolism
blin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLSMQ_3747
   00290 Valine, leucine and isoleucine biosynthesis
    BLSMQ_3747
   00220 Arginine biosynthesis
    BLSMQ_3747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:blin01007]
    BLSMQ_3747
Enzymes [BR:blin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BLSMQ_3747
    2.6.1.66  valine---pyruvate transaminase
     BLSMQ_3747
Amino acid related enzymes [BR:blin01007]
 Aminotransferase (transaminase)
  Class I
   BLSMQ_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AOP55445
UniProt: A0A1D7W904
LinkDB All DBs
Position
4078777..4080045
Genome map
AA seq 422 aa AA seqDB search
MYRQSSKLANVLYDIRGPVLEEAEAMEAKGHTILKLNIGNPAPFGFEAPEAIVHDMVKQL
PVAQGYSDSRGILSGRRAVVQYYETRGIHNLDTLEVFLGNGVSELITLSLQALCNPGDEI
LVPSPDYPLWTASVALAGGTPKHYLCDEATAWQPDLEDLESKITENTRGIVVINPNNPTG
AVYSRETLKKIVDIARRHDLIIFADEIYEKITYDDVEMVNMATLTGDDVLCLTYSGLSKA
YRIAGYRAGWLAITGPLSEAKSYLEGIKLLANMRMCANVPAQHAIQAALGGKQSIEDLVL
PQGRLGAQMNLAHEGLNSIDGVSAHRASGALYMFAKLDVDKFNITDDEQFALDLLREQKI
LVSHGTAFNWSSPDHFRLVTLPSVEVLDESINRLGEFLSGYQQNAPSTCELPTVKEMSPA
AG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggcagtcgtcgaaattggccaatgtcctctatgacattcggggacccgtcctc
gaagaggccgaggcgatggaggccaagggccacaccatcctcaagctcaacatcggcaac
cctgcacctttcggattcgaagcccccgaggcgatcgtccacgacatggtcaaacagctg
cccgtggctcaggggtactcggattcccgtggaatcctctccggtcgccgcgccgtcgtc
cagtactacgagaccagaggcatccacaatctggacaccctcgaggtgttcctgggcaac
ggagtcagcgaactcatcaccctgtccctgcaggccctgtgcaatcccggcgacgagatc
ctcgtccccagccccgactatcccctgtggacggcatcggtcgccctggccggcggcacc
cccaagcactacctgtgcgacgaagccaccgcctggcagcccgacctcgaggatctcgaa
tcgaagatcaccgagaacacccgcggcatcgtcgtcatcaatccgaacaacccgacgggt
gcggtctactcacgcgagactctgaagaagatcgtcgacatcgcacgccgccacgacctc
atcatcttcgccgacgagatctacgagaagatcacctacgacgacgtcgagatggtcaat
atggctaccctgaccggtgacgatgtcctgtgcctgacctactcgggactgtcgaaggcc
taccggatcgccggctaccgcgccggctggctggccatcaccggaccgctgtccgaggcc
aagagctacctcgagggcatcaaactcctggccaatatgcgcatgtgcgccaacgttccc
gcccagcacgcaatccaggcggcactcggcggcaagcagtcgatcgaggacctggtcctt
ccgcagggtcgcctcggtgcgcagatgaacctcgcgcatgaggggctgaactccatcgac
ggtgtctccgcgcaccgagccagcggtgccctctacatgttcgcgaagctcgatgtcgac
aaattcaacatcaccgatgacgaacagttcgccctcgacctgctgcgcgaacagaagatc
ctcgtctcccacggcaccgccttcaactggtcgagccccgaccacttccggctcgtcacc
ctgccctccgtcgaggtcctggacgaatcgatcaaccgcctcggcgagttcctctccggg
tatcagcagaacgcacccagcacctgcgagctgccgaccgtcaaggagatgtcgccagct
gcggggtaa

DBGET integrated database retrieval system