KEGG   Bifidobacterium longum DJO10A: BLD_0906Help
Entry
BLD_0906          CDS       T00707                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00473  D-Alanine metabolism
blj01100  Metabolic pathways
blj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BLD_0906 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BLD_0906 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blj01011]
    BLD_0906 (alr)
Enzymes [BR:blj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BLD_0906 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:blj01011]
 Precursor biosynthesis
  Racemase
   BLD_0906 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACD98352
UniProt: B3DT83
LinkDB All DBs
Position
complement(1040807..1042159)
Genome map
AA seq 450 aa AA seqDB search
MNAAPEIAFSSEQGKANYAAARRQYPAQAIVDLKTMRDNMAHLVSVVGGPASGTAVMGVV
KADAYGHGLLPAALAALAGGATWLGTAQSHEALLLRKLGIGPDRCHILTWVYNGTEVPFD
ELIAADIDVSVGSLPGIDAVAAAARKLGKPARVHVKVDSGFGRNGFTPAGFDAALAKLVP
LAKEGVLHIVGQWSHLAVADSPDVSEFVSSTDRQIETFKDFTRRMEQAGIPPEIRHLANT
AATLDRPEIHFELTRPGIGLYGYEPDPAMGTPRDWHLTPAMRLQAQLGTVKDVEAGHGIS
YGRTYLTLDNTSTAIVPLGYADGIHRSASGFDMEGAKHVEKPGGPVRIMTTEGPKIYRVC
GRVCMDQFIVDLHGSAAELGVHEGDTVELFGPGRGEDYVEPTADDWARAADTISYEIFTC
LRNRIPRLYEHAAEVLPAADLAKLDPATLL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcacctgaaatcgcattctcgtccgagcagggcaaggccaactatgcggcc
gcccgccgccaataccccgcacaggccatcgtggacctcaaaaccatgcgcgacaacatg
gcccacctggtctccgtggtcggcgggcccgcttccggcacggcggtgatgggtgtggtc
aaggccgacgcctacggccacggactgctgcccgccgccctggccgcgctcgccggcggc
gccacatggctcggcaccgcgcagtcgcacgaagcgttgctgctgcgcaagctcggcatc
ggccccgaccgctgccatattttgacttgggtatacaacggcaccgaagtcccgttcgac
gagctgatcgccgccgacatcgacgtatcggtcggctccctgcccggcatcgacgcggtg
gccgccgccgcacgcaagctcggcaagcccgcccgcgtacacgtcaaggtcgattccggc
ttcggtcgcaacggtttcacaccggccggattcgacgccgcgctcgccaaactcgtgccg
ctcgccaaagagggcgtgttgcatattgtgggtcagtggagccatctcgccgtggccgat
tcgcccgatgtgtccgaattcgtgtcctccaccgaccgccagatcgaaacattcaaggac
ttcacgcgccgcatggaacaggccggcattccgccggagatccgtcacctggccaacaca
gcggccactttggaccgcccggagattcacttcgaactcacccgccccggcatcggcctg
tacggctacgagcccgatcccgcgatgggcaccccgcgcgactggcatctgaccccggcc
atgcgcctgcaggcgcagctcggcacggtcaaggatgtggaggccggccacggcatctcc
tacggccgcacctacctgaccctggacaacacctcgaccgctattgtgccgctgggctac
gccgatggcatccaccgctccgcttccggtttcgatatggaaggtgccaagcacgtggag
aagccgggcggcccggtgcgcatcatgaccaccgaaggcccgaagatctaccgcgtgtgc
ggccgcgtgtgcatggaccagttcatcgtggacctgcacggatccgccgccgaactcggc
gttcacgagggcgacacggtcgaactgttcggcccgggccgcggcgaggattacgttgag
cctaccgccgacgattgggcccgcgccgccgacaccatcagctacgagatcttcacctgc
ctgcgcaaccgcatcccgcgcctttacgagcatgccgccgaagtgctgcccgccgccgac
ctcgccaaactcgaccccgccacgctgctataa

DBGET integrated database retrieval system