KEGG   Bifidobacterium longum DJO10A: BLD_0913Help
Entry
BLD_0913          CDS       T00707                                 

Gene name
metC3
Definition
(GenBank) Cystathionine beta-lyases/cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00270  Cysteine and methionine metabolism
blj00450  Selenocompound metabolism
blj00920  Sulfur metabolism
blj01100  Metabolic pathways
blj01110  Biosynthesis of secondary metabolites
blj01130  Biosynthesis of antibiotics
blj01230  Biosynthesis of amino acids
Module
blj_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:blj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BLD_0913 (metC3)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BLD_0913 (metC3)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BLD_0913 (metC3)
Enzymes [BR:blj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     BLD_0913 (metC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACD98359
UniProt: B3DT90
LinkDB All DBs
Position
complement(1051060..1052244)
Genome map
AA seq 394 aa AA seqDB search
MSAEYNAKFANTDIATRAIHAGQEPDPTTGAVVTPIFATSTFKQDGVLGLRGGHDYSRSI
NPTRTSFDEQLAAVEGGKYALSFSSGLAAIDVLLRSTIKPGDNILLGNDVYGGTYRLLSK
VFVPWGVGLDVVDITDLKAVETALASKHYQYVWVETPSNPLLNITDIAATTEVAHKYGTK
VAVDNTFASPALQHPLADGADVVVYSTTKYIGGHSDVVGGAVVVNDEETREKVAFLQNAA
GAVPSPFDSWLDIRGLKTLDLRVKRHSANALKVAEWLESQPSDVIERVWYPGLESHPGHE
IAARQMHGGFGGIVSVQLAAGAEAAKHFVDHTQIFTLAESLGGVESLIEVPAAMTHASVA
GTTLQVPANLVRISVGIENADDLIADLKQALDRI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgaatacaacgccaagttcgccaacaccgacatcgccactcgcgccatccac
gccggccaggagcccgacccgactaccggtgcggtcgtcacgccgatcttcgccacctcc
actttcaagcaggatggcgtgttgggcctcaggggaggccacgactactcccgctccatc
aaccccactcgcaccagcttcgacgagcagctcgccgccgtggaaggcggcaagtacgcg
ctgagcttctcctcgggcttggccgccatcgacgtgctgctgcgctccaccatcaagccc
ggcgacaacatcctgctcggcaacgatgtgtacggcggcacctaccgcctgctctccaag
gtgttcgtgccgtggggtgtgggcctcgacgtggtggacatcaccgatctgaaagccgtg
gaaaccgcattggcctccaagcactaccagtatgtgtgggtcgagaccccgtccaacccg
ctgctcaacatcaccgacatcgcggccaccaccgaagtcgcccacaagtacggcaccaag
gtcgctgtcgacaacaccttcgcctcgcccgcccttcagcacccgctggccgatggcgcc
gatgtggtggtctactccaccaccaagtacatcggcggccactccgacgtggtcggcggt
gccgtggtggtcaacgatgaggagacccgcgagaaggtcgccttcctgcagaacgccgcc
ggcgcagtgccctccccgttcgactcctggctggacatccgcggcctgaagaccctggat
ctgcgcgtcaagcgccacagcgccaacgccctgaaggtggccgaatggctcgaatcccag
ccctctgatgtgattgagcgcgtctggtacccgggcctcgagtcccacccgggtcatgaa
atcgccgcccgccagatgcacggcggcttcggcggcatcgtctccgtgcagctcgcggcc
ggcgccgaggcggccaagcacttcgtggaccacacgcagatcttcacactggccgaatcg
ctcggcggtgtggaaagcctcatcgaggtgcccgccgccatgacccacgcctccgtggcc
ggcaccaccctgcaggtgcccgccaacctggtgcgcatttcggtcggtatcgagaacgcc
gacgaccttatcgccgatctcaagcaggcgttggatcgtatctga

DBGET integrated database retrieval system