KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00276Help
Entry
BLNIAS_00276      CDS       T01845                                 

Gene name
tdh3
Definition
(GenBank) threonine dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00040  Pentose and glucuronate interconversions
blk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLNIAS_00276 (tdh3)
Enzymes [BR:blk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BLNIAS_00276 (tdh3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEI96752
UniProt: F8AS50
LinkDB All DBs
Position
244986..246026
Genome map
AA seq 346 aa AA seqDB search
MKAVVLEEQGVINVREVPDVKDPGPGELRIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMI
LGHEAAGTVLEVGPGVTDFKPGDRVALEPGIPDMTSRASRLGMYNVDPAVRFFATPPIDG
CLCEEVIHPAAFTYHLPDSMSFGEGALLEPTAVGMWAATKARIKPGDVCVVTGSGTVGML
TASAALAGGASKVLVSDVSSIKLGIIGQIPGVIPVDLTTEDLVERVREETAGWGADVAFE
CSGAPKAYETFWKLIAPGGCAVLVGIPVNPVPIDVTELQATEVRIENIFRYANVYQKAID
LVDSGRLNLKPFITDTFAMKDAKAAFDRMDEGRPGDIKLQITVNRD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgttctcgaagagcagggcgtcatcaatgtgcgtgaggtcccggacgtc
aaggatcccggccccggtgagctgcgtatcgcaccccacaccgtgggcgtatgcggttct
gatttgcattactacacgcacggtcgtgttggcaagtatgttgttgagcagccaatgatt
ctcggccatgaggcagcgggcaccgtgttggaggtcggccccggcgtcactgatttcaag
cccggtgaccgagtcgccctcgagccaggcattccggatatgacttcgcgggccagccga
ctgggcatgtacaacgtcgatccggctgtgcgtttcttcgctactccgccgattgacggt
tgcctgtgtgaggaggtcattcacccggccgcattcacctaccatctgcctgattccatg
agctttggcgaaggtgcgttgcttgagccgaccgccgtgggcatgtgggctgccaccaag
gcgcgcatcaagcccggcgatgtgtgcgtggtgaccggctcgggcacagtgggtatgctc
actgcctctgctgcgctcgccggtggcgcttccaaggtgcttgtttcggatgtgtcttcc
atcaagctgggtattatcggccagattccgggcgttatccccgtggatttgacgacggag
gacttggttgaacgtgtacgcgaagagaccgctgggtggggcgctgatgtggcattcgag
tgttccggcgcgccgaaagcttatgagacgttctggaagctgattgccccgggcggttgc
gcggtgctcgtcggtattccggtcaacccggtaccgattgacgtgaccgagctgcaggcc
accgaagtgcgtattgagaacatcttccgttacgccaatgtgtaccagaaagccatcgat
ttggtcgatagcggccgacttaacctgaagccgttcatcactgacacgtttgccatgaag
gacgccaaggctgccttcgaccgtatggatgagggtcgtccgggcgatatcaagttgcag
attacggtcaatcgagactaa

DBGET integrated database retrieval system