KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02776Help
Entry
BLNIAS_02776      CDS       T01845                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00620  Pyruvate metabolism
blk00680  Methane metabolism
blk01100  Metabolic pathways
blk01120  Microbial metabolism in diverse environments
blk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLNIAS_02776 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    BLNIAS_02776 (ppc)
Enzymes [BR:blk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BLNIAS_02776 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEI98428
UniProt: F8AUP1
LinkDB All DBs
Position
2228029..2230782
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEILRNVLGEYNPELLSTF
DTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVPVDQAVDPINELTVAYHQLINETGPAKAKELLNQLEFHPVFTAH
PTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKSLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLADLKVVQRSLAAAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTEMTERYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALGDREDLNEKVLNEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgaagaacagatcactcccgctgacgccgccatcgtcactaccgggacc
ggccgaaagggcccggaggagcatgatcttcccgaaagcctgaagtacgacatggatctg
tgtcttgagatcctgcgtaacgtactgggcgaatacaaccccgaactgctgtctacgttc
gacaccgtgcgtcattacgcggtggaggccagcgccgagcatttcgccgagctgaaggat
ccgaaccccgaccaggatggcctgaaggaggccgtgaacgtcatcgacaacatgacgttg
cacgacgcccagctgctggcccgcgcattcgccacgtatttccatctggcaaacctgtcc
gaggagaactaccgcgtttccgtgctccacgagcgcgagaacaacgtgcccgttgaccag
gcggtcgatccgatcaacgagctcaccgtcgcctaccaccagctcatcaatgagactggc
ccggccaaggccaaggaactgctcaaccagctcgaattccaccccgtcttcacggcgcac
cccactgaggcccgtcgtaaggccgtggaaggcaagatccgccgcgtttccgaattgctt
gaggagtacaagcgcctcggcggctcggataagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccgatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttcaacaccatccccaaggtc
taccgtcgcttcgatgactgggtcctgggcgataaggccggtctcgtcgagcccgcttgc
cccgcgttcttccacccgggcagctggatcggctccgaccgcgacggtaacccgaacgtc
accgccaaggtgagccgcgccgtggcccgcaagttctccgatcacgtaatcgccgccctt
gaggaagccacccgcaccgtgggccgcaacctcacgatggaagccgagaccacgccgccg
agcgccgagctcaagagcctctggagccaccagaaggaaatgagcgagcgtctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgac
cgtctgcactacaccatcgagcgcgacgccgacctcatgtaccactcctgcgacgacttc
ctcgccgacctcaaggtggtccagcgttcgctggccgccgccggtgccaagcgttccgct
tacggcccgctgcaggatctgatctggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcatgcccgcgcccttgcggatatccgcgagcac
ggtctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgctctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggcattc
tcccacccggaggacgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ctgcagaactcggtggacgtgctcgaggaaatgatcaagatccccgaggtccaggctcgt
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgactcctcgaaggac
gccggcccgacctccgccacgctggccctgcactccgctcaggagcgcatcgccaagtgg
gctgagtcgcacgacatcgacctgaccctgttccatggccgcggcggcgccgtcggtcgt
ggcggcggccccgccaaccgcgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcgaccttgctgcagtccgcgccgagcgtggag
aagcgcaacaccgagatgaccgagaggtatgccgacatggccgctcagctcgacgaggcc
gcgcacaaccgcttcctcgacctgttgaacaccgacggctttgccccgtggttctcgatc
gttacgccgctgaccgaaatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctcggcgccaagtcgctcgacgacctgcgcacgattccgtggatcttctcctgggctcag
gcccgcatcaacctggccgcctggtacggtctcggcaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcttacgaggaatggccgctgttctccaccttcatcgacaac
atcgagatgtccatcgccaagacggatgagcgcatcgccaggatgtaccttgccctcggc
gaccgcgaggacctcaatgagaaggtgctcaacgagatggagctcacccgcaagtgggtt
ctggccatcgtgggcgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcatccgctccccgtacgtggacgcgctgtccgtcacccaggtgctcgccctcaggtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctac
ctcatcctgtgcaccgtctccggcgtcgccgcgggcctgcagaacacgggctga

DBGET integrated database retrieval system