KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0402Help
Entry
BLJ_0402          CDS       T01240                                 

Definition
(GenBank) L-ribulose-5-phosphate 4-epimerase
  KO
K03077  L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00040  Pentose and glucuronate interconversions
bll00053  Ascorbate and aldarate metabolism
bll01100  Metabolic pathways
bll01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLJ_0402
   00053 Ascorbate and aldarate metabolism
    BLJ_0402
Enzymes [BR:bll01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     BLJ_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADG99881
UniProt: D6ZY85
LinkDB All DBs
Position
483959..484651
Genome map
AA seq 230 aa AA seqDB search
MATLADYGPEVRAEVKQVREVVSNLHQQLIKWNLVVWTAGNVSQRLHTADLFVIKPSGLR
YEYLTPSSMVVCDLDGNVVDGAEAPSSDTASHAYIYRNMPDVYGVVHTHSTYATAWAATG
QNIPCGLTMMGDEFGGPVPVGPFRLIGSEAIGKGVVETLKKYPKSPAVLMQNHGPFTIGK
DAEGAVKAAAMTEEVAHTMWAARQLGDIIEIDQADIDKLNDRYQNVYGQH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttggctgattacggccccgaggttcgcgccgaggtcaagcaggttcgtgag
gtcgtctccaacctgcaccagcagctgatcaagtggaacctggtcgtgtggaccgcgggc
aacgtttcccagcgtctgcacaccgccgacctgttcgtcatcaagccctccggcctgcgc
tacgagtacctgaccccgtcctccatggtcgtgtgcgaccttgacggcaacgtggtcgac
ggtgccgaagccccgtcctcggacaccgcttcccacgcctacatctaccgcaacatgccc
gacgtctacggtgtcgtgcacacccattccacctacgccaccgcttgggctgccactggt
cagaacatcccgtgcggcctgacgatgatgggcgacgagttcggcggcccggtgccggtg
ggcccgttccgtctgatcggctcggaggcgatcggcaagggtgtcgtcgagaccctcaag
aagtacccgaagtccccggccgtcctcatgcagaaccatggccccttcaccatcggcaag
gatgctgaaggcgccgtcaaggccgctgccatgaccgaggaagtcgctcacaccatgtgg
gccgcccgtcagctcggtgacatcatcgagatcgaccaggccgacatcgataagctcaac
gaccgctaccagaacgtctacggccagcactga

DBGET integrated database retrieval system