KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1341Help
Entry
BLLJ_1341         CDS       T01419                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00052  Galactose metabolism
blm00500  Starch and sucrose metabolism
blm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BLLJ_1341
   00500 Starch and sucrose metabolism
    BLLJ_1341
Enzymes [BR:blm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BLLJ_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: BAJ67008
LinkDB All DBs
Structure
PDB: 

Position
1588806..1590362
Genome map
AA seq 518 aa AA seqDB search
MTDFTPETPVLTPIRDHAAELAKAEAGVAEMAAKRNNRWYPKYHIASNGGWINDPNGLCF
YKGLWHVFYQLHPYGTQWGPMHWGHVSSTDMLSWKREPIMFAPSLEQEKDGVFSGSAVID
DNGDLRFYYTGHRWANGHDNTGGDWQVQMTALPDNDELTSATKQGMIIDCPTDKVDHHYR
DPKVWKTGDTWYMTFGVSSADKRGQMWLFSSKDMVRWEYERVLFQHPDPDVFMLECPDFF
PIKDKDGNEKWVIGFSAMGSKPSGFMNRNVSNAGYMIGTWEPGGEFKPETEFRLWDCGHN
YYAPQSFNVEGRQIVYGWMSPFVQPIPMEDDGWCGQLTLPREITLGDDGDVVTAPVAEME
GLREDTLDHGSITLDMDGEQIIADDAEAVEIEMTIDLAASTAERAGLKIHATEDGAYTYV
AYDDQIGRVVVDRQAMANGDRGYRAAPLTDAELASGKLDLRVFVDRGSVEVYVNGGHQVL
SSYSYASEGPRAIKLVAESGSLKVDSLKLHHMKSIGLE
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttcactcccgaaacccctgttctcacccccatccgcgaccacgctgctgaa
ctggcaaaagccgaagccggcgtggctgagatggccgccaagcgcaacaaccgctggtac
ccgaagtatcacatcgcctccaacggtggctggatcaacgacccgaacggcctgtgcttc
tacaagggcctctggcacgtgttctaccagctgcacccctacggcacccagtggggtccg
atgcactggggccacgtctcctccaccgacatgctcagctggaagcgcgagcccatcatg
ttcgcaccgtctctagagcaggagaaggacggcgtgttctccggttccgccgtcatcgac
gacaacggcgaccttcgcttctactacaccggccaccgttgggccaacggccacgacaac
accggcggcgactggcaggtgcagatgaccgcgctgccggacaatgacgagctcacctcc
gccaccaagcagggcatgatcatcgactgcccgaccgacaaggtcgaccaccactaccgc
gacccgaaggtctggaagaccggcgacacctggtacatgaccttcggtgtctcctctgcg
gacaagcgcggccagatgtggctgttctcctccaaggacatggtccgctgggaatacgag
cgcgtgctcttccagcacccggatccggatgtgttcatgctcgaatgccccgacttcttc
cccatcaaagacaaggacggcaacgagaagtgggtcattggcttctccgccatggggtcc
aagcccagcggcttcatgaaccgcaacgtcagcaacgccggctacatgatcggcacgtgg
gagccgggcggcgaattcaagccggaaaccgagttccgcctgtgggattgcggccacaac
tactacgccccgcagtccttcaatgtggaaggccgtcagatcgtctatggctggatgagc
ccgttcgtgcagccgattcccatggaggatgacggctggtgtggccagctcaccctgccg
cgcgagatcactcttggtgatgacggcgacgtggtcaccgcgccggtcgccgaaatggaa
ggcctgcgcgaggataccctcgaccatggttcgatcacactcgacatggatggcgagcag
atcatcgccgatgacgccgaggccgtggaaatcgaaatgaccatcgacttggctgcctcc
actgccgagcgtgcgggtctgaagattcacgccactgaggacggtgcctacacctacgtg
gcttatgacgaccagatcggccgcgtggtggtggatcgtcaggccatggccaacggcgat
cgcggctaccgcgccgccccactgaccgacgccgaactggcctccggcaagctggacctg
cgcgtgttcgtggatcgcggctccgtggaggtctacgtcaacggtggccaccaagtgctg
agctcctactcctacgcctccgaaggcccgcgcgccatcaagctcgtcgccgagtccggt
agtctcaaggtggattccctgaagctccaccacatgaagtccatcggactggagtag

DBGET integrated database retrieval system