KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0059Help
Entry
Blon_0059         CDS       T00794                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00620  Pyruvate metabolism
bln00680  Methane metabolism
bln01100  Metabolic pathways
bln01120  Microbial metabolism in diverse environments
bln01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Blon_0059
  09102 Energy metabolism
   00680 Methane metabolism
    Blon_0059
Enzymes [BR:bln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Blon_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACJ51189
UniProt: B7GSL1
LinkDB All DBs
Position
complement(66467..69220)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEILRNVLGEYNPELLSTF
DTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSVDQAVDPINELTVAYHQLINETGPAKAKELLNQLEFHPVFTAH
PTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKSLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDDFLADLKVVQRSLAAAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTEMTERYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIARMYLALGDREDLNEKVLNEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgaagaacagatcactcccgctgacgccgccatcgtcactaccgggacc
ggccgaaagggcccggaggagcatgatcttcccgaaagcctgaagtacgacatggatctg
tgtcttgagatcctgcgtaacgtactgggcgaatacaaccccgaactgctgtctacgttc
gacaccgtgcgtcattacgcggtggaggccagcgccgagcatttcgccgagctgaaggat
ccgaaccccgaccaggatggcctgaaggaggccgtgaacgtcatcgacaacatgacgttg
cacgacgcccagctgctggcccgcgcgttcgccacgtatttccatctggcaaacctgtcc
gaggagaactaccgtgtttccgtgctccacgagcgcgagaacaacgtgtccgttgaccag
gcggtcgacccgatcaacgagctcaccgtcgcctaccaccagctcatcaatgagactggc
ccggccaaggccaaggaactgctcaaccagctcgaattccaccccgtcttcacggcgcac
cccactgaggcccgtcgtaaggccgtggaaggcaagatccgccgcgtttccgaattgctt
gaggagtacaagcgcctcggcggctcggataagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccgatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttcaacaccatccccaaggtc
taccgtcgcttcgacgactgggtcctgggcgataaggccggtctcgtcgagcccgcttgc
cccgcgttcttccacccgggcagctggatcggctccgaccgcgacggtaacccgaacgtc
accgccaaggtgagccgcgccgtggcccgcaagttctccgatcacgtgatcgccgccctt
gaggaagccacccgcaccgtgggccgcaacctcacgatggaagccgagaccacgccgcca
agcgccgagctcaaaagcctctggagccaccagaaggaaatgagcgagcgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgat
cgtctgcactacaccatcgagcgcgatgccgacctcatgtaccactcctgcgacgacttc
ctcgccgacctcaaggtggtccagcgttcgctggccgccgccggtgccaagcgttccgct
tacggcccgctgcaggatctgatctggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcac
ggcctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgccctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggccttc
tcccacccggaggacgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ctgcagaactcggtggacgtgctcgaggaaatgatcaagatccccgaggttcaggctcgt
ctgaaggccaccggcaacaagctcgaggtcatgctcggctactccgactcctcgaaggac
gccggcccgacctccgccacgctggccctgcactccgctcaggagcgcatcgccaaatgg
gctgagtcgcacgacatcgacctgaccctgttccatggccgcggcggtgccgtcggtcgt
ggcggcggccccgccaaccgcgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgagcagggcgaggtcatcttcgcccgttacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcgaccttgctgcagtccgcgccgagcgtggag
aagcgcaacaccgagatgaccgagaggtacgccgacatggccgctcagctcgacgaggcc
gcgcacaaccgtttcctcgacctgttgaacaccgatggcttcgctccgtggttctcgatc
gttacgccgctgaccgaaatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctcggcgccaagtcgctcgacgacctgcgtacgattccgtggatcttctcctgggcccag
gcccgcatcaacctggccgcttggtacggtctcggcaccgcatgcgagaagttcggcgat
ctggagaccatgcgtcaggcttacgaggaatggccgctgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggatgagcgcatcgccaggatgtaccttgccctcggc
gaccgcgaggacctcaatgagaaggtgctcaacgagatggagctcacccgcaagtgggtt
ctggccatcgtgggtgacaagtggccgctgcagcaccgtcacgtgctcggccaggccatc
cgcatccgctccccatacgtggacgcgctgtccgtcactcaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcagagccaacaggccggattcatctac
ctcatcctgtgcaccgtctccggcgtcgccgcgggcctgcagaacacgggctga

DBGET integrated database retrieval system