KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0320Help
Entry
Blon_0320         CDS       T00794                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00473  D-Alanine metabolism
bln00550  Peptidoglycan biosynthesis
bln01100  Metabolic pathways
bln01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Blon_0320
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Blon_0320
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Blon_0320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bln01011]
    Blon_0320
Enzymes [BR:bln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Blon_0320
Peptidoglycan biosynthesis and degradation proteins [BR:bln01011]
 Precursor biosynthesis
  Amino acid ligase
   Blon_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACJ51445
UniProt: B7GU04
LinkDB All DBs
Position
370875..372062
Genome map
AA seq 395 aa AA seqDB search
MAKKRVVVLYGGRADEHSISCISTAGVLGAMDTERFEPIPVGITKDGKWIINGEDPRGWN
LDGGELPTVKITPESRPVMLDPSRGQDGFFIGEPSHINSADSGFGTSFVSMPDPEMHHAL
TSLGHVDAVLPVLHGPYGEDGTVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLGAAGI
PTAPGVTVDARNFTAADVLAKIEDAGLTYPLFIKPSRAGSSFGVTKVEKADDRETQQDRL
AAAIATAGEHDWKVLVEQGIDGREIECAVLCPKAGDEPEASWPGEIVLDHQNDDQFYDFD
SKYMDASASHVEVPANLPVSVLEDVRDVARRAFKAVDGAGLSRVDTFVTPDGTVMVNEIN
TMPGFTPISMYPKAWDATGVSYTELITRLIEGVLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagcgtgttgtggtgctctatggtgggcgtgcagacgagcattcgatttcc
tgcatctccactgccggtgtgctgggggccatggacactgaacggttcgagccgattccg
gtcggcatcaccaaggacggcaagtggatcatcaacggcgaagatcctcgtggctggaac
ttggacggcggcgagctgccgaccgtaaagatcaccccggaatcgcgcccggtgatgctt
gacccctctcgcggccaggacggtttcttcatcggcgagcccagccacatcaattccgcc
gattccggcttcggcaccagcttcgtcagcatgcccgacccggaaatgcaccatgcgctg
acctcccttggccatgtggacgcggtactgccggtgctgcacggcccctatggcgaggac
ggcacggttcaaggcctgctggaaatgatgggtgtgccgtacgtggggtgcggagtgttt
gcttccgccgcctgcatggataagcattacaccaaggtggtgctgggtgccgccggcatt
cccaccgcgccgggtgtgacggtcgatgcgcgcaacttcaccgccgccgatgtgcttgcc
aagatcgaggacgccggtcttacctatccgctgttcatcaagccttcgcgcgcaggctcc
agcttcggtgtgaccaaggtcgagaaagccgatgaccgcgagacccagcaggatcgtctg
gccgccgccatcgccaccgccggcgagcacgattggaaggtgctcgtcgaacaggggatt
gatggccgcgaaatcgaatgtgccgtgctgtgtccgaaggccggtgacgagcctgaagcc
agctggcccggcgaaatcgtgctcgatcatcagaacgacgaccagttctacgatttcgac
tccaagtacatggatgcctccgccagccacgtggaagtgcctgccaatctgccagtcagc
gtgcttgaggacgtgcgtgacgtggcccggcgtgcgttcaaggccgtggatggtgccggc
ttgagccgtgtggacaccttcgtgacgcctgatggcacggtgatggtcaacgaaatcaac
accatgcccggcttcacgccgatttctatgtatcccaaggcttgggatgccaccggagtg
agctacaccgaactcatcacgcgattgattgagggtgtgctgaggtag

DBGET integrated database retrieval system