KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1065Help
Entry
Blon_1065         CDS       T00794                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01130  Biosynthesis of antibiotics
bln01230  Biosynthesis of amino acids
bln02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Blon_1065
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Blon_1065
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Blon_1065
Enzymes [BR:bln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Blon_1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACJ52157
UniProt: B7GQS7
LinkDB All DBs
Position
1247450..1249006
Genome map
AA seq 518 aa AA seqDB search
MSECSVKHLKWGATWPSREQFHELADAGYRVIPIVRRLLADSLTPVGFYERLAGGRSGTF
ILESAEYGGTWSRYSFIGVNSMAQLRSNNGQADWLGKVPVGVPVTGDVVEVAHATLKTLK
APHVEGLPNLTSGLIGTVGWDAIRHWEPTLRAEAPDETGQPETVLALATDIAVVDHVSGS
VWLIANAVNVDDKSTRADAAYNEAVARLDQMQRDAATPAPDESRVNILDETVTQPELRFR
TEKSHYEQAVKRAKQHIVDGDVFQVVISQRLDIDSPADPFDVYRVLRTLNPSPYMYFMAL
TDAQGRDFNVIGSSPETLIKVDNGHAMTFPIAGSRPRGATPEEDEKFAKELLADPKERSE
HIMLVDLSRNDLSKVCVPQSVEVVQLMDIKRFSHIMHICSTVTGKVDPSLTAFDVFKSAF
PAGTLSGAPKPRAVEIIDELEPADRGIYGGTVGYFDFSGNMDMAIAIRTAFLRDHEASVQ
AGAGIVLDSVPATEWQETRNKAEASVESIQIAAQLREL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatgcagcgtcaaacacctgaagtggggcgccacctggcccagtcgcgaacag
ttccacgaactggccgacgccggctaccgtgtgattccgatcgtgcgccgtctgctcgcc
gactcgctcaccccggtcggcttctacgagcgtctcgccggcggccgatccggcaccttc
atcctcgaatcggcggaatacggcggcacgtggagccgttacagcttcatcggcgtcaac
tcgatggcccaactgcgctccaacaacggtcaggccgactggctgggcaaggtcccggtc
ggcgtgcccgtcaccggtgacgtggtcgaagtcgctcacgccacgttgaagactctgaag
gccccgcatgtggaaggcctgccgaacctgaccagcggtctgatcggcacggtcggctgg
gatgccatccgccactgggaaccgaccctgcgcgccgaagctccggacgagaccggacag
cctgagaccgtgcttgccctggccaccgatatcgccgtggtcgaccacgtatccggttcg
gtatggctcatcgccaatgcggtgaatgtggatgataaatccactcgcgccgacgccgcc
tacaacgaggccgtcgctcgactcgaccagatgcagcgcgatgccgccaccccggctccg
gacgagtcccgcgtcaacattctggacgaaacggtcacccaacccgagctgcgcttccgc
accgagaagagccactacgagcaggccgtcaaacgcgccaagcagcacatcgtcgacggc
gacgtgttccaggtggtcatctcccagcgcctcgacatcgattcgcctgctgacccgttc
gacgtgtaccgtgtgttgcgcacgctgaacccgagcccgtacatgtatttcatggcgttg
accgacgctcagggccgcgacttcaacgtgatcggctccagcccggaaaccctcatcaag
gtggacaacggccacgcgatgaccttcccgattgctggatcccgccctcgcggcgccacc
cctgaggaagacgagaaattcgccaaggagctgcttgccgatccgaaggaacgcagcgag
cacatcatgctcgtcgacctgtctcgcaacgacctgagtaaggtgtgcgtgccgcagtcc
gtggaagtcgtgcagctcatggacatcaagcgtttcagccacatcatgcacatctgctcg
acggtcaccggcaaggtcgacccctcgctgactgcattcgatgtgttcaagtccgcgttc
ccggccggcacgctgtctggcgctcctaagccgcgcgcagtcgaaatcatcgacgagttg
gaaccggccgaccgcggcatctacggcggcaccgtcggctacttcgatttctccggcaac
atggacatggccatcgccatccgcaccgcgttcctgcgtgaccatgaggcgagcgtgcag
gccggtgccggcattgtgctcgactccgtgcccgccaccgaatggcaggagacgcgcaac
aaggccgaggccagcgtcgaatccatccagatcgccgcccagctgcgcgaactgtaa

DBGET integrated database retrieval system