KEGG   Bifidobacterium longum NCC2705: BL0345Help
Entry
BL0345            CDS       T00094                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00473  D-Alanine metabolism
blo00550  Peptidoglycan biosynthesis
blo01100  Metabolic pathways
blo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:blo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BL0345 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BL0345 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BL0345 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:blo01011]
    BL0345 (ddl)
Enzymes [BR:blo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BL0345 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:blo01011]
 Precursor biosynthesis
  Amino acid ligase
   BL0345 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 1023250
NCBI-ProteinID: NP_695548
UniProt: Q8G7C4
LinkDB All DBs
Position
complement(1276319..1277605)
Genome map
AA seq 428 aa AA seqDB search
MRLLCAAFRARFGPVGGAKHRLENGCSFNKRMVMAKKRVVVLYGGRADEHSISCISTAGV
LGAMDTERFEPIPVGITKDGKWIINGEDPRGWNLDGGELPTVKITPESRPVMLDPSRGQD
GFFIGEPSHINSADSGFGTSFVSMSDPEMHHVLTSLGHVDAVLPVLHGPYGEDGTVQGLL
EMMGVPYVGCGVFASAACMDKHYTKVVLDAAGIPTAPGVTVDARNFTAADVLAEIEDAGL
TYPLFVKPSRAGSSFGVTKVEKADDRETQQDRLAAAIATAGEHDWKVLVEQGIDGREIEC
AVLCPKAGDEPEASWPGEIVLDHQNDDQFYDFDSKYMDASASHVEVPANLPVSVLEDVRD
VARRAFKAVDGAGLSRVDTFVTPDGTVMVNEINTMPGFTPISMYPKAWDATGVSYTELIT
RLIEGVLR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtctcttgtgcgcggcgttccgagcgcggttcggtccggttggcggtgcaaagcat
aggcttgaaaacggttgtagtttcaacaaaaggatggttatggccaagaagcgtgttgtg
gtgctctatggtgggcgtgcagacgagcattcgatttcctgcatctccactgccggtgtg
ctgggggccatggacactgaacggttcgagccgattccggtcggcatcaccaaggacggc
aagtggatcatcaatggcgaagatccgcgtggctggaacttggacggcggcgagctgccg
accgtaaagatcaccccggaatcgcgcccggtgatgcttgacccctctcgcggacaggac
ggtttcttcatcggcgagcccagccacatcaattccgccgattccggcttcggcaccagc
ttcgtcagcatgtccgacccggaaatgcaccatgtgctgacctcccttggccatgtggac
gcggtactgccggtgctgcacggcccctatggcgaggatggtacggttcaaggcctgctg
gaaatgatgggtgtgccgtacgtggggtgcggagtgtttgcttccgccgcctgcatggat
aagcattacaccaaggtggtactggatgccgccggcattcccaccgcgcccggtgtgacg
gtcgatgcgcgcaacttcaccgccgccgatgtgcttgccgagatcgaggacgccggtctt
acttatccgctgtttgtcaagccttcgcgcgcaggctccagcttcggtgtgaccaaggtc
gagaaagccgatgaccgcgagacccagcaggatcgtctggccgccgccatcgccaccgcc
ggcgagcacgactggaaggtgctcgtcgaacaggggattgatggtcgcgaaatcgaatgt
gccgtgctgtgcccgaaggccggtgacgagcccgaggccagctggcccggcgaaatcgtg
ctcgatcatcagaacgacgaccagttctacgatttcgactccaagtacatggatgcctcc
gccagccacgtggaagtgcctgccaatctgccggtcagcgtgcttgaggacgtgcgtgac
gtggcccgtcgcgcgttcaaggccgtggatggtgccggcttgagccgtgtggacaccttc
gtgacgcctgatggcacggtgatggtcaacgaaatcaacaccatgcccggcttcacgccg
atttccatgtatcccaaggcttgggatgccaccggagtgagctacaccgaactcatcacg
cgattgattgagggcgtgctgaggtaa

DBGET integrated database retrieval system